Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1494621..1495258 Replicon chromosome
Accession NZ_CP128531
Organism Mannheimia haemolytica strain 120731

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QTV67_RS07780 Protein ID WP_040080900.1
Coordinates 1494621..1494926 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QTV67_RS07785 Protein ID WP_040080901.1
Coordinates 1494938..1495258 (+) Length 107 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV67_RS07735 1489631..1490830 - 1200 WP_230269034.1 terminase -
QTV67_RS07740 1490833..1491330 - 498 WP_040080897.1 hypothetical protein -
QTV67_RS07745 1491345..1491500 - 156 WP_006250103.1 hypothetical protein -
QTV67_RS07750 1491763..1491996 - 234 WP_162839428.1 hypothetical protein -
QTV67_RS07755 1491962..1492291 - 330 WP_040080898.1 DUF2570 family protein -
QTV67_RS07760 1492292..1492888 - 597 WP_020824120.1 glycoside hydrolase family 19 protein -
QTV67_RS07765 1492903..1493262 - 360 WP_165876904.1 phage holin, lambda family -
QTV67_RS07770 1493398..1493871 - 474 WP_006251969.1 antiterminator Q family protein -
QTV67_RS07775 1493861..1494430 - 570 WP_040080899.1 recombination protein NinG -
QTV67_RS07780 1494621..1494926 + 306 WP_040080900.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QTV67_RS07785 1494938..1495258 + 321 WP_040080901.1 HigA family addiction module antitoxin Antitoxin
QTV67_RS07790 1495325..1495783 + 459 WP_040080902.1 hypothetical protein -
QTV67_RS07795 1495837..1496877 - 1041 WP_040080778.1 IS481 family transposase -
QTV67_RS07800 1497012..1497473 - 462 WP_020824123.1 DUF1367 family protein -
QTV67_RS07805 1497494..1498096 - 603 WP_040080903.1 DNA N-6-adenine-methyltransferase -
QTV67_RS07810 1498093..1498740 - 648 WP_032844508.1 replication protein P -
QTV67_RS07815 1498740..1499513 - 774 WP_240517759.1 hypothetical protein -
QTV67_RS07820 1499510..1499692 - 183 WP_230269038.1 helix-turn-helix domain-containing protein -
QTV67_RS07825 1499807..1500250 - 444 WP_006252074.1 YmfL family putative regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1472224..1514496 42272
- flank IS/Tn - - 1495837..1496877 1040


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(8-97)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(4-82)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11995.61 Da        Isoelectric Point: 6.4692

>T284821 WP_040080900.1 NZ_CP128531:1494621-1494926 [Mannheimia haemolytica]
MFNLTEAHFRDEALYRFFQYGEVSRTIPANLTSVLARKLDMINAAEKLNDLRSPPANRLELLEPKQNNVYSIRVNKQYRL
IFKFENNELSDLYLDPHNYDL

Download         Length: 306 bp

Antitoxin


Download         Length: 107 a.a.        Molecular weight: 12089.80 Da        Isoelectric Point: 6.2152

>AT284821 WP_040080901.1 NZ_CP128531:1494938-1495258 [Mannheimia haemolytica]
MMQRKPTPVGEILQEEFLAPLNLKIGDLVEILDVHRNTASNLVNNSCRVSPEMAFKLAKAFDTSPEFWLNLQTATDLWEL
RHNNRFQQSLDSVKAVNHWQGVPAFA

Download         Length: 321 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References