284814

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1570909..1571546 Replicon chromosome
Accession NZ_CP128530
Organism Mannheimia haemolytica strain 131633

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QTV58_RS08160 Protein ID WP_040080900.1
Coordinates 1570909..1571214 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QTV58_RS08165 Protein ID WP_040080901.1
Coordinates 1571226..1571546 (+) Length 107 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV58_RS08115 1565919..1567118 - 1200 WP_230269034.1 terminase -
QTV58_RS08120 1567121..1567618 - 498 WP_040080897.1 hypothetical protein -
QTV58_RS08125 1567633..1567788 - 156 WP_006250103.1 hypothetical protein -
QTV58_RS08130 1568051..1568284 - 234 WP_162839428.1 hypothetical protein -
QTV58_RS08135 1568250..1568579 - 330 WP_040080898.1 DUF2570 family protein -
QTV58_RS08140 1568580..1569176 - 597 WP_020824120.1 glycoside hydrolase family 19 protein -
QTV58_RS08145 1569191..1569550 - 360 WP_165876904.1 phage holin, lambda family -
QTV58_RS08150 1569686..1570159 - 474 WP_006251969.1 antiterminator Q family protein -
QTV58_RS08155 1570149..1570718 - 570 WP_040080899.1 recombination protein NinG -
QTV58_RS08160 1570909..1571214 + 306 WP_040080900.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QTV58_RS08165 1571226..1571546 + 321 WP_040080901.1 HigA family addiction module antitoxin Antitoxin
QTV58_RS08170 1571613..1572071 + 459 WP_040080902.1 hypothetical protein -
QTV58_RS08175 1572125..1573165 - 1041 WP_040080492.1 IS481 family transposase -
QTV58_RS08180 1573300..1573761 - 462 WP_020824123.1 DUF1367 family protein -
QTV58_RS08185 1573782..1574384 - 603 WP_040080903.1 DNA N-6-adenine-methyltransferase -
QTV58_RS08190 1574381..1575028 - 648 WP_032844508.1 replication protein P -
QTV58_RS08195 1575028..1575801 - 774 WP_240517759.1 hypothetical protein -
QTV58_RS08200 1575798..1575980 - 183 WP_230269038.1 helix-turn-helix domain-containing protein -
QTV58_RS08205 1576095..1576538 - 444 WP_006252074.1 YmfL family putative regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1548176..1590784 42608
- flank IS/Tn - - 1572125..1573165 1040


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(8-97)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(4-82)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11995.61 Da        Isoelectric Point: 6.4692

>T284814 WP_040080900.1 NZ_CP128530:1570909-1571214 [Mannheimia haemolytica]
MFNLTEAHFRDEALYRFFQYGEVSRTIPANLTSVLARKLDMINAAEKLNDLRSPPANRLELLEPKQNNVYSIRVNKQYRL
IFKFENNELSDLYLDPHNYDL

Download         Length: 306 bp

Antitoxin


Download         Length: 107 a.a.        Molecular weight: 12089.80 Da        Isoelectric Point: 6.2152

>AT284814 WP_040080901.1 NZ_CP128530:1571226-1571546 [Mannheimia haemolytica]
MMQRKPTPVGEILQEEFLAPLNLKIGDLVEILDVHRNTASNLVNNSCRVSPEMAFKLAKAFDTSPEFWLNLQTATDLWEL
RHNNRFQQSLDSVKAVNHWQGVPAFA

Download         Length: 321 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References