Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1541122..1541759 Replicon chromosome
Accession NZ_CP128523
Organism Mannheimia haemolytica strain 182812

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QTV55_RS07850 Protein ID WP_040080900.1
Coordinates 1541122..1541427 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QTV55_RS07855 Protein ID WP_040080901.1
Coordinates 1541439..1541759 (+) Length 107 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QTV55_RS07815 1537334..1537831 - 498 WP_040080897.1 hypothetical protein -
QTV55_RS07820 1538264..1538497 - 234 WP_162839428.1 hypothetical protein -
QTV55_RS07825 1538463..1538792 - 330 WP_040080898.1 DUF2570 family protein -
QTV55_RS07830 1538793..1539389 - 597 WP_020824120.1 glycoside hydrolase family 19 protein -
QTV55_RS07835 1539404..1539763 - 360 WP_165876904.1 phage holin, lambda family -
QTV55_RS07840 1539899..1540372 - 474 WP_006251969.1 antiterminator Q family protein -
QTV55_RS07845 1540362..1540931 - 570 WP_040080899.1 recombination protein NinG -
QTV55_RS07850 1541122..1541427 + 306 WP_040080900.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QTV55_RS07855 1541439..1541759 + 321 WP_040080901.1 HigA family addiction module antitoxin Antitoxin
QTV55_RS07860 1541826..1542284 + 459 WP_040080902.1 hypothetical protein -
QTV55_RS07865 1542338..1543378 - 1041 WP_040080492.1 IS481 family transposase -
QTV55_RS07870 1543513..1543974 - 462 WP_020824123.1 DUF1367 family protein -
QTV55_RS07875 1543995..1544597 - 603 WP_040080903.1 DNA N-6-adenine-methyltransferase -
QTV55_RS07880 1544594..1545241 - 648 WP_032844508.1 replication protein P -
QTV55_RS07885 1545241..1546014 - 774 WP_240517759.1 hypothetical protein -
QTV55_RS07890 1546011..1546193 - 183 WP_230269038.1 helix-turn-helix domain-containing protein -
QTV55_RS07895 1546308..1546751 - 444 WP_006252074.1 YmfL family putative regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1518389..1560997 42608
- flank IS/Tn - - 1542338..1543378 1040


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(8-97)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(4-82)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11995.61 Da        Isoelectric Point: 6.4692

>T284755 WP_040080900.1 NZ_CP128523:1541122-1541427 [Mannheimia haemolytica]
MFNLTEAHFRDEALYRFFQYGEVSRTIPANLTSVLARKLDMINAAEKLNDLRSPPANRLELLEPKQNNVYSIRVNKQYRL
IFKFENNELSDLYLDPHNYDL

Download         Length: 306 bp

Antitoxin


Download         Length: 107 a.a.        Molecular weight: 12089.80 Da        Isoelectric Point: 6.2152

>AT284755 WP_040080901.1 NZ_CP128523:1541439-1541759 [Mannheimia haemolytica]
MMQRKPTPVGEILQEEFLAPLNLKIGDLVEILDVHRNTASNLVNNSCRVSPEMAFKLAKAFDTSPEFWLNLQTATDLWEL
RHNNRFQQSLDSVKAVNHWQGVPAFA

Download         Length: 321 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References