Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5405418..5406013 | Replicon | chromosome |
| Accession | NZ_CP128507 | ||
| Organism | Pseudomonas aeruginosa strain WS27-3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | QUC27_RS25165 | Protein ID | WP_003113526.1 |
| Coordinates | 5405735..5406013 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QUC27_RS25160 | Protein ID | WP_003099268.1 |
| Coordinates | 5405418..5405723 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QUC27_RS25125 (QUC27_25125) | 5400557..5401405 | + | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| QUC27_RS25135 (QUC27_25135) | 5401572..5402513 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| QUC27_RS25140 (QUC27_25140) | 5402630..5403244 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| QUC27_RS25145 (QUC27_25145) | 5403286..5403870 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| QUC27_RS25150 (QUC27_25150) | 5403911..5405011 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| QUC27_RS25160 (QUC27_25160) | 5405418..5405723 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| QUC27_RS25165 (QUC27_25165) | 5405735..5406013 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QUC27_RS25170 (QUC27_25170) | 5406066..5406194 | - | 129 | Protein_4972 | integrase | - |
| QUC27_RS25175 (QUC27_25175) | 5406342..5408570 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
| QUC27_RS25180 (QUC27_25180) | 5408640..5409287 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| QUC27_RS25185 (QUC27_25185) | 5409349..5410587 | - | 1239 | WP_121295756.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T284681 WP_003113526.1 NZ_CP128507:c5406013-5405735 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|