Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5366756..5367351 | Replicon | chromosome |
| Accession | NZ_CP128506 | ||
| Organism | Pseudomonas aeruginosa strain Fe11-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | QUC24_RS24855 | Protein ID | WP_003117425.1 |
| Coordinates | 5367073..5367351 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QUC24_RS24850 | Protein ID | WP_003113527.1 |
| Coordinates | 5366756..5367061 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QUC24_RS24835 (QUC24_24835) | 5362093..5363529 | + | 1437 | WP_023122806.1 | HAD-IA family hydrolase | - |
| QUC24_RS24840 (QUC24_24840) | 5363533..5364492 | + | 960 | WP_078459576.1 | DNA-processing protein DprA | - |
| QUC24_RS24845 (QUC24_24845) | 5364527..5365399 | - | 873 | WP_023122808.1 | DUF4868 domain-containing protein | - |
| QUC24_RS24850 (QUC24_24850) | 5366756..5367061 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| QUC24_RS24855 (QUC24_24855) | 5367073..5367351 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QUC24_RS24860 (QUC24_24860) | 5367404..5367532 | - | 129 | Protein_4910 | integrase | - |
| QUC24_RS24865 (QUC24_24865) | 5367680..5369908 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| QUC24_RS24870 (QUC24_24870) | 5369978..5370625 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| QUC24_RS24875 (QUC24_24875) | 5370687..5371925 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T284675 WP_003117425.1 NZ_CP128506:c5367351-5367073 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|