Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5393731..5394326 | Replicon | chromosome |
Accession | NZ_CP128505 | ||
Organism | Pseudomonas aeruginosa strain Fe8-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | QUC25_RS24995 | Protein ID | WP_003113526.1 |
Coordinates | 5394048..5394326 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QUC25_RS24990 | Protein ID | WP_003133769.1 |
Coordinates | 5393731..5394036 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUC25_RS24960 (QUC25_24960) | 5389297..5389587 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
QUC25_RS24965 (QUC25_24965) | 5389763..5390035 | - | 273 | WP_004352675.1 | hypothetical protein | - |
QUC25_RS24970 (QUC25_24970) | 5390476..5390811 | + | 336 | WP_025921265.1 | hypothetical protein | - |
QUC25_RS24975 (QUC25_24975) | 5390972..5392348 | + | 1377 | WP_071534372.1 | DUF3696 domain-containing protein | - |
QUC25_RS24980 (QUC25_24980) | 5392345..5392827 | + | 483 | WP_071534371.1 | hypothetical protein | - |
QUC25_RS24985 (QUC25_24985) | 5392988..5393395 | - | 408 | WP_052151012.1 | hypothetical protein | - |
QUC25_RS24990 (QUC25_24990) | 5393731..5394036 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
QUC25_RS24995 (QUC25_24995) | 5394048..5394326 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QUC25_RS25000 (QUC25_25000) | 5394379..5394507 | - | 129 | Protein_4938 | integrase | - |
QUC25_RS25005 (QUC25_25005) | 5394655..5396883 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
QUC25_RS25010 (QUC25_25010) | 5396954..5397601 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
QUC25_RS25015 (QUC25_25015) | 5397663..5398901 | - | 1239 | WP_043085810.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T284670 WP_003113526.1 NZ_CP128505:c5394326-5394048 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|