Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4734247..4734928 | Replicon | chromosome |
| Accession | NZ_CP128505 | ||
| Organism | Pseudomonas aeruginosa strain Fe8-1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QUC25_RS21905 | Protein ID | WP_015503432.1 |
| Coordinates | 4734563..4734928 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A643IYQ7 |
| Locus tag | QUC25_RS21900 | Protein ID | WP_034071998.1 |
| Coordinates | 4734247..4734570 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QUC25_RS21875 (QUC25_21875) | 4730563..4731201 | + | 639 | WP_003109444.1 | hypothetical protein | - |
| QUC25_RS21880 (QUC25_21880) | 4731444..4731779 | + | 336 | WP_060853238.1 | TM2 domain-containing protein | - |
| QUC25_RS21885 (QUC25_21885) | 4731953..4732471 | + | 519 | WP_003140886.1 | PAAR domain-containing protein | - |
| QUC25_RS21890 (QUC25_21890) | 4732468..4732713 | + | 246 | WP_289344355.1 | hypothetical protein | - |
| QUC25_RS21895 (QUC25_21895) | 4732783..4733871 | + | 1089 | WP_003140888.1 | DUF3396 domain-containing protein | - |
| QUC25_RS21900 (QUC25_21900) | 4734247..4734570 | - | 324 | WP_034071998.1 | XRE family transcriptional regulator | Antitoxin |
| QUC25_RS21905 (QUC25_21905) | 4734563..4734928 | - | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QUC25_RS21910 (QUC25_21910) | 4735192..4735431 | - | 240 | WP_048521765.1 | hypothetical protein | - |
| QUC25_RS21915 (QUC25_21915) | 4735638..4735910 | + | 273 | WP_003124230.1 | hypothetical protein | - |
| QUC25_RS21920 (QUC25_21920) | 4735941..4736366 | - | 426 | WP_003116492.1 | VOC family protein | - |
| QUC25_RS21925 (QUC25_21925) | 4736467..4737351 | + | 885 | WP_003140892.1 | LysR substrate-binding domain-containing protein | - |
| QUC25_RS21930 (QUC25_21930) | 4737324..4738277 | - | 954 | WP_289344356.1 | LysR substrate-binding domain-containing protein | - |
| QUC25_RS21935 (QUC25_21935) | 4738498..4738932 | + | 435 | WP_003158601.1 | RidA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T284669 WP_015503432.1 NZ_CP128505:c4734928-4734563 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|