Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrG-as-bsrG/- |
Location | 1624209..1624459 | Replicon | chromosome |
Accession | NZ_CP128501 | ||
Organism | Bacillus amyloliquefaciens strain SRCM123386 |
Toxin (Protein)
Gene name | bsrG | Uniprot ID | L8EAY0 |
Locus tag | QTN46_RS08670 | Protein ID | WP_009967548.1 |
Coordinates | 1624343..1624459 (-) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | as-bsrG | ||
Locus tag | - | ||
Coordinates | 1624209..1624348 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN46_RS08655 (1620526) | 1620526..1621506 | - | 981 | WP_220176660.1 | thermonuclease family protein | - |
QTN46_RS08660 (1621678) | 1621678..1623564 | + | 1887 | WP_289394352.1 | T7SS effector LXG polymorphic toxin | - |
QTN46_RS08665 (1623577) | 1623577..1624035 | + | 459 | WP_014470070.1 | YrhA family protein | - |
- (1624209) | 1624209..1624348 | + | 140 | NuclAT_0 | - | Antitoxin |
- (1624209) | 1624209..1624348 | + | 140 | NuclAT_0 | - | Antitoxin |
- (1624209) | 1624209..1624348 | + | 140 | NuclAT_0 | - | Antitoxin |
- (1624209) | 1624209..1624348 | + | 140 | NuclAT_0 | - | Antitoxin |
QTN46_RS08670 (1624343) | 1624343..1624459 | - | 117 | WP_009967548.1 | type I toxin-antitoxin system toxin BsrG | Toxin |
QTN46_RS08675 (1624688) | 1624688..1624891 | + | 204 | WP_289394353.1 | hypothetical protein | - |
QTN46_RS08680 (1625018) | 1625018..1625791 | + | 774 | WP_147785872.1 | sporulation protein YunB | - |
QTN46_RS08685 (1626010) | 1626010..1626342 | + | 333 | WP_014470072.1 | YolD-like family protein | - |
QTN46_RS08690 (1626335) | 1626335..1627585 | + | 1251 | WP_289394355.1 | UV damage repair protein UvrX | - |
QTN46_RS08695 (1627749) | 1627749..1628909 | - | 1161 | WP_289394356.1 | tetratricopeptide repeat protein | - |
QTN46_RS08700 (1629061) | 1629061..1629366 | - | 306 | WP_289394357.1 | collagen-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1618564..1761486 | 142922 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4336.39 Da Isoelectric Point: 10.1022
>T284657 WP_009967548.1 NZ_CP128501:c1624459-1624343 [Bacillus amyloliquefaciens]
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
MTVYESLMIMINFGGLILNTVLLIFNIMMIVTSSQKKK
Download Length: 117 bp
Antitoxin
Download Length: 140 bp
>AT284657 NZ_CP128501:1624209-1624348 [Bacillus amyloliquefaciens]
AAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCACCCCGGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCG
ATGTTGAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTT
AAATGCATAAAATAAAAAGACCAGGGTGTTGGTAGCACCCCGGCTCTGTACAAAAAGCTGCCCATCAAAGGGCTTGCTCG
ATGTTGAATCTGCGTAGACCTAACCCTTTAAGGTTCCTAAGCTCAAGGGAAGGTCTATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|