Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 1068440..1068972 | Replicon | chromosome |
Accession | NZ_CP128492 | ||
Organism | Novosphingobium resinovorum strain HR1a |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A1D8A0G5 |
Locus tag | QUC32_RS14835 | Protein ID | WP_069707532.1 |
Coordinates | 1068703..1068972 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | QUC32_RS14830 | Protein ID | WP_289357645.1 |
Coordinates | 1068440..1068706 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUC32_RS14815 (QUC32_14815) | 1063462..1065390 | - | 1929 | WP_069707529.1 | EAL domain-containing protein | - |
QUC32_RS14820 (QUC32_14820) | 1065582..1068062 | + | 2481 | WP_069707530.1 | ATP-dependent helicase HrpB | - |
QUC32_RS14825 (QUC32_14825) | 1068108..1068386 | + | 279 | WP_008830939.1 | ETC complex I subunit | - |
QUC32_RS14830 (QUC32_14830) | 1068440..1068706 | + | 267 | WP_289357645.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QUC32_RS14835 (QUC32_14835) | 1068703..1068972 | + | 270 | WP_069707532.1 | Txe/YoeB family addiction module toxin | Toxin |
QUC32_RS14845 (QUC32_14845) | 1069227..1071131 | + | 1905 | WP_037519972.1 | DNA polymerase III subunit gamma/tau | - |
QUC32_RS14850 (QUC32_14850) | 1071133..1071468 | + | 336 | WP_008830943.1 | YbaB/EbfC family nucleoid-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10502.94 Da Isoelectric Point: 10.0505
>T284646 WP_069707532.1 NZ_CP128492:1068703-1068972 [Novosphingobium resinovorum]
VKIVFASRTWEDYQHWVANDRTTLERLNALIEQCRRTPFKGTGKPEPLKGELQGWWSRRINQADRLVYRVAGSGAEQRLE
IAQCRFHYV
VKIVFASRTWEDYQHWVANDRTTLERLNALIEQCRRTPFKGTGKPEPLKGELQGWWSRRINQADRLVYRVAGSGAEQRLE
IAQCRFHYV
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|