Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 350624..351270 | Replicon | chromosome |
| Accession | NZ_CP128487 | ||
| Organism | Klebsiella pneumoniae strain YZEF2-2C | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A483JFR4 |
| Locus tag | QTN20_RS03615 | Protein ID | WP_004188313.1 |
| Coordinates | 350624..350971 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A483GM64 |
| Locus tag | QTN20_RS03620 | Protein ID | WP_004188315.1 |
| Coordinates | 350971..351270 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTN20_RS03605 (346550) | 346550..347983 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| QTN20_RS03610 (348001) | 348001..350448 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| QTN20_RS03615 (350624) | 350624..350971 | + | 348 | WP_004188313.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QTN20_RS03620 (350971) | 350971..351270 | + | 300 | WP_004188315.1 | XRE family transcriptional regulator | Antitoxin |
| QTN20_RS03625 (351333) | 351333..352841 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| QTN20_RS03630 (353046) | 353046..353375 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| QTN20_RS03635 (353426) | 353426..354256 | + | 831 | WP_004188317.1 | rhomboid family intramembrane serine protease GlpG | - |
| QTN20_RS03640 (354306) | 354306..355064 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13548.57 Da Isoelectric Point: 6.2327
>T284633 WP_004188313.1 NZ_CP128487:350624-350971 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483JFR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483GM64 |