Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 4049091..4049688 | Replicon | chromosome |
Accession | NZ_CP128466 | ||
Organism | Klebsiella variicola strain 22KM2707 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QSV42_RS20080 | Protein ID | WP_012968756.1 |
Coordinates | 4049371..4049688 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QSV42_RS20075 | Protein ID | WP_012542525.1 |
Coordinates | 4049091..4049378 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSV42_RS20045 (QSV42_20040) | 4045001..4045249 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
QSV42_RS20050 (QSV42_20045) | 4045266..4045607 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
QSV42_RS20055 (QSV42_20050) | 4045638..4046753 | - | 1116 | WP_162493283.1 | MBL fold metallo-hydrolase | - |
QSV42_RS20060 (QSV42_20055) | 4046933..4047514 | + | 582 | WP_012968754.1 | TetR/AcrR family transcriptional regulator | - |
QSV42_RS20065 (QSV42_20060) | 4047514..4047882 | + | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
QSV42_RS20070 (QSV42_20065) | 4048002..4048655 | + | 654 | WP_012968755.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
QSV42_RS20075 (QSV42_20070) | 4049091..4049378 | - | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QSV42_RS20080 (QSV42_20075) | 4049371..4049688 | - | 318 | WP_012968756.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QSV42_RS20085 (QSV42_20080) | 4049873..4050916 | - | 1044 | WP_016160437.1 | DUF2157 domain-containing protein | - |
QSV42_RS20090 (QSV42_20085) | 4051446..4052312 | - | 867 | WP_008805530.1 | helix-turn-helix transcriptional regulator | - |
QSV42_RS20095 (QSV42_20090) | 4052421..4053848 | + | 1428 | WP_049009040.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12124.41 Da Isoelectric Point: 11.2767
>T284619 WP_012968756.1 NZ_CP128466:c4049688-4049371 [Klebsiella variicola]
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
IKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
IKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|