Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2770331..2770667 | Replicon | chromosome |
Accession | NZ_CP128464 | ||
Organism | Enterococcus faecalis strain RE25 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | E2Z0W4 |
Locus tag | QSV41_RS14055 | Protein ID | WP_002381035.1 |
Coordinates | 2770331..2770474 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2770618..2770667 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSV41_RS14035 | 2766424..2767062 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
QSV41_RS14040 | 2767748..2769364 | + | 1617 | WP_002389442.1 | phosphatase PAP2/LCP family protein | - |
QSV41_RS14045 | 2769699..2769842 | + | 144 | WP_002389461.1 | type I toxin-antitoxin system toxin PepG1 | - |
QSV41_RS14050 | 2769966..2770100 | + | 135 | WP_153829595.1 | putative holin-like toxin | - |
QSV41_RS14055 | 2770331..2770474 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
- | 2770618..2770667 | + | 50 | - | - | Antitoxin |
QSV41_RS14060 | 2770669..2774496 | - | 3828 | WP_010816211.1 | WxL domain-containing protein | - |
QSV41_RS14065 | 2774483..2774845 | - | 363 | WP_002378868.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T284609 WP_002381035.1 NZ_CP128464:2770331-2770474 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT284609 NZ_CP128464:2770618-2770667 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|