Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2427301..2427959 | Replicon | chromosome |
Accession | NZ_CP128435 | ||
Organism | Morganella morganii subsp. morganii strain QLYYMMQL588 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7T9XFK0 |
Locus tag | QSV29_RS11940 | Protein ID | WP_024473887.1 |
Coordinates | 2427606..2427959 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | J7TDD0 |
Locus tag | QSV29_RS11935 | Protein ID | WP_004236876.1 |
Coordinates | 2427301..2427603 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSV29_RS11895 | 2423667..2424362 | - | 696 | WP_024473885.1 | MgtC family protein | - |
QSV29_RS11900 | 2424713..2424907 | - | 195 | WP_015422621.1 | protein DsrB | - |
QSV29_RS11905 | 2425011..2425223 | - | 213 | WP_004240014.1 | transcription antiterminator/RNA stability regulator CspE | - |
QSV29_RS11910 | 2425684..2426193 | + | 510 | WP_024473886.1 | YlaC family protein | - |
QSV29_RS11935 | 2427301..2427603 | - | 303 | WP_004236876.1 | XRE family transcriptional regulator | Antitoxin |
QSV29_RS11940 | 2427606..2427959 | - | 354 | WP_024473887.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QSV29_RS11945 | 2428236..2429288 | + | 1053 | WP_024473888.1 | dihydroorotase | - |
QSV29_RS11950 | 2429523..2429780 | + | 258 | WP_024473889.1 | biofilm formation regulator BssS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13648.63 Da Isoelectric Point: 9.9631
>T284567 WP_024473887.1 NZ_CP128435:c2427959-2427606 [Morganella morganii subsp. morganii]
VWKIVTTDNFTVWFAEQDDGDRAAILAAMLVLEKRGPGLPRPYADTVKGSRYTNMKELRIQSRGQPIRAFFAFDPERRGV
LLCAGYKTGKEKRFYMQMIPQADREYTEWLNRPENRS
VWKIVTTDNFTVWFAEQDDGDRAAILAAMLVLEKRGPGLPRPYADTVKGSRYTNMKELRIQSRGQPIRAFFAFDPERRGV
LLCAGYKTGKEKRFYMQMIPQADREYTEWLNRPENRS
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|