Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2006310..2006958 | Replicon | chromosome |
Accession | NZ_CP128435 | ||
Organism | Morganella morganii subsp. morganii strain QLYYMMQL588 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QSV29_RS09735 | Protein ID | WP_024473062.1 |
Coordinates | 2006614..2006958 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QSV29_RS09730 | Protein ID | WP_024473063.1 |
Coordinates | 2006310..2006609 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSV29_RS09710 | 2001759..2001965 | + | 207 | WP_024473067.1 | hypothetical protein | - |
QSV29_RS09715 | 2002374..2004761 | + | 2388 | WP_036407993.1 | molybdopterin-dependent oxidoreductase | - |
QSV29_RS09720 | 2004758..2005387 | + | 630 | WP_214167311.1 | dimethylsulfoxide reductase subunit B | - |
QSV29_RS09725 | 2005384..2006256 | + | 873 | WP_289647534.1 | dimethyl sulfoxide reductase anchor subunit | - |
QSV29_RS09730 | 2006310..2006609 | - | 300 | WP_024473063.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QSV29_RS09735 | 2006614..2006958 | - | 345 | WP_024473062.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QSV29_RS09740 | 2007114..2007281 | - | 168 | WP_289647535.1 | hypothetical protein | - |
QSV29_RS09745 | 2007286..2010372 | - | 3087 | WP_205501287.1 | efflux RND transporter permease subunit | - |
QSV29_RS09750 | 2010369..2011457 | - | 1089 | WP_205501288.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13172.07 Da Isoelectric Point: 9.3450
>T284566 WP_024473062.1 NZ_CP128435:c2006958-2006614 [Morganella morganii subsp. morganii]
VRTVLLTDYFNEWLSGQDTRMQEKVLASLGNLEIYGPVLTRPYVDTVKNSQYPNMKELRIWHAGRAIRAFFAFDSERQAI
VLCAGDKGKNKRFYQTMIRIADEQFSSYLAAAKE
VRTVLLTDYFNEWLSGQDTRMQEKVLASLGNLEIYGPVLTRPYVDTVKNSQYPNMKELRIWHAGRAIRAFFAFDSERQAI
VLCAGDKGKNKRFYQTMIRIADEQFSSYLAAAKE
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|