Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2176175..2176438 | Replicon | chromosome |
Accession | NZ_CP128389 | ||
Organism | Staphylococcus aureus strain 21-024 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | QTN91_RS10425 | Protein ID | WP_001802298.1 |
Coordinates | 2176175..2176279 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2176274..2176438 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN91_RS10390 (QTN91_10390) | 2172074..2172682 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
QTN91_RS10395 (QTN91_10395) | 2172972..2173754 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
QTN91_RS10400 (QTN91_10400) | 2173822..2174679 | + | 858 | WP_000370942.1 | HAD family hydrolase | - |
QTN91_RS10405 (QTN91_10405) | 2174809..2174901 | - | 93 | WP_000220902.1 | hypothetical protein | - |
QTN91_RS10410 (QTN91_10410) | 2175337..2175495 | - | 159 | WP_001792784.1 | hypothetical protein | - |
QTN91_RS10415 (QTN91_10415) | 2175488..2175658 | - | 171 | WP_001807897.1 | hypothetical protein | - |
QTN91_RS10420 (QTN91_10420) | 2175916..2176014 | + | 99 | Protein_2046 | resolvase | - |
QTN91_RS10425 (QTN91_10425) | 2176175..2176279 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 2176274..2176438 | - | 165 | - | - | Antitoxin |
QTN91_RS10435 (QTN91_10435) | 2176777..2177868 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
QTN91_RS10440 (QTN91_10440) | 2178134..2179114 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
QTN91_RS10445 (QTN91_10445) | 2179116..2179436 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
QTN91_RS10450 (QTN91_10450) | 2179588..2180253 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T284538 WP_001802298.1 NZ_CP128389:2176175-2176279 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT284538 NZ_CP128389:c2176438-2176274 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|