Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1880462..1880646 | Replicon | chromosome |
Accession | NZ_CP128389 | ||
Organism | Staphylococcus aureus strain 21-024 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | QTN91_RS08865 | Protein ID | WP_000482647.1 |
Coordinates | 1880462..1880569 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1880586..1880646 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN91_RS08840 (QTN91_08840) | 1875819..1876292 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
QTN91_RS08845 (QTN91_08845) | 1876415..1877626 | - | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
QTN91_RS08850 (QTN91_08850) | 1877814..1878473 | - | 660 | WP_000831300.1 | hypothetical protein | - |
QTN91_RS08855 (QTN91_08855) | 1878533..1879675 | - | 1143 | WP_001176859.1 | glycerate kinase | - |
QTN91_RS08860 (QTN91_08860) | 1879942..1880328 | + | 387 | WP_000779355.1 | flippase GtxA | - |
QTN91_RS08865 (QTN91_08865) | 1880462..1880569 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1880586..1880646 | - | 61 | - | - | Antitoxin |
QTN91_RS08870 (QTN91_08870) | 1881273..1883036 | + | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein | - |
QTN91_RS08875 (QTN91_08875) | 1883061..1884794 | + | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein | - |
QTN91_RS08880 (QTN91_08880) | 1885025..1885192 | + | 168 | WP_001798790.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T284537 WP_000482647.1 NZ_CP128389:1880462-1880569 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT284537 NZ_CP128389:c1880646-1880586 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|