Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2181469..2181748 | Replicon | chromosome |
Accession | NZ_CP128388 | ||
Organism | Staphylococcus aureus strain 21-074 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | QTN92_RS10400 | Protein ID | WP_001802298.1 |
Coordinates | 2181469..2181573 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2181569..2181748 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN92_RS10375 (QTN92_10375) | 2177368..2177919 | + | 552 | WP_289211166.1 | TIR domain-containing protein | - |
QTN92_RS10380 (QTN92_10380) | 2178266..2179048 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
QTN92_RS10385 (QTN92_10385) | 2179116..2179973 | + | 858 | WP_000370942.1 | HAD family hydrolase | - |
QTN92_RS10390 (QTN92_10390) | 2180631..2180789 | - | 159 | WP_001792784.1 | hypothetical protein | - |
QTN92_RS10395 (QTN92_10395) | 2181210..2181308 | + | 99 | Protein_2041 | resolvase | - |
QTN92_RS10400 (QTN92_10400) | 2181469..2181573 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 2181569..2181748 | - | 180 | - | - | Antitoxin |
QTN92_RS10410 (QTN92_10410) | 2182137..2183228 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
QTN92_RS10415 (QTN92_10415) | 2183494..2184474 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
QTN92_RS10420 (QTN92_10420) | 2184476..2184796 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
QTN92_RS10425 (QTN92_10425) | 2184948..2185613 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T284528 WP_001802298.1 NZ_CP128388:2181469-2181573 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT284528 NZ_CP128388:c2181748-2181569 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|