Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2181463..2181726 | Replicon | chromosome |
Accession | NZ_CP128387 | ||
Organism | Staphylococcus aureus strain 22-042 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | QTN90_RS10455 | Protein ID | WP_001802298.1 |
Coordinates | 2181463..2181567 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2181562..2181726 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QTN90_RS10420 (QTN90_10420) | 2177362..2177913 | + | 552 | WP_289211166.1 | TIR domain-containing protein | - |
QTN90_RS10425 (QTN90_10425) | 2178260..2179042 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
QTN90_RS10430 (QTN90_10430) | 2179110..2179967 | + | 858 | WP_000370942.1 | HAD family hydrolase | - |
QTN90_RS10435 (QTN90_10435) | 2180097..2180189 | - | 93 | WP_000220902.1 | hypothetical protein | - |
QTN90_RS10440 (QTN90_10440) | 2180625..2180783 | - | 159 | WP_001792784.1 | hypothetical protein | - |
QTN90_RS10445 (QTN90_10445) | 2180776..2180946 | - | 171 | WP_001807897.1 | hypothetical protein | - |
QTN90_RS10450 (QTN90_10450) | 2181204..2181302 | + | 99 | Protein_2052 | resolvase | - |
QTN90_RS10455 (QTN90_10455) | 2181463..2181567 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 2181562..2181726 | - | 165 | - | - | Antitoxin |
QTN90_RS10465 (QTN90_10465) | 2182131..2183222 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
QTN90_RS10470 (QTN90_10470) | 2183488..2184468 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
QTN90_RS10475 (QTN90_10475) | 2184470..2184790 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
QTN90_RS10480 (QTN90_10480) | 2184942..2185607 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T284516 WP_001802298.1 NZ_CP128387:2181463-2181567 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT284516 NZ_CP128387:c2181726-2181562 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|