Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 1885679..1885863 | Replicon | chromosome |
| Accession | NZ_CP128387 | ||
| Organism | Staphylococcus aureus strain 22-042 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | QTN90_RS08885 | Protein ID | WP_000482647.1 |
| Coordinates | 1885679..1885786 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 1885803..1885863 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QTN90_RS08860 (QTN90_08860) | 1881036..1881509 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
| QTN90_RS08865 (QTN90_08865) | 1881632..1882843 | - | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
| QTN90_RS08870 (QTN90_08870) | 1883031..1883690 | - | 660 | WP_000831300.1 | hypothetical protein | - |
| QTN90_RS08875 (QTN90_08875) | 1883750..1884892 | - | 1143 | WP_001176859.1 | glycerate kinase | - |
| QTN90_RS08880 (QTN90_08880) | 1885159..1885545 | + | 387 | WP_000779355.1 | flippase GtxA | - |
| QTN90_RS08885 (QTN90_08885) | 1885679..1885786 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 1885803..1885863 | - | 61 | - | - | Antitoxin |
| QTN90_RS08890 (QTN90_08890) | 1886490..1888253 | + | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein | - |
| QTN90_RS08895 (QTN90_08895) | 1888278..1890011 | + | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein | - |
| QTN90_RS08900 (QTN90_08900) | 1890242..1890409 | + | 168 | WP_001798790.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T284515 WP_000482647.1 NZ_CP128387:1885679-1885786 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT284515 NZ_CP128387:c1885863-1885803 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|