Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 51256..51520 | Replicon | plasmid pIncI1-ST12 |
| Accession | NZ_CP128262 | ||
| Organism | Salmonella enterica subsp. enterica serovar Heidelberg isolate FT3-7B | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | QR684_RS23380 | Protein ID | WP_001303307.1 |
| Coordinates | 51368..51520 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 51256..51318 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QR684_RS23365 (46495) | 46495..48786 | - | 2292 | WP_001289271.1 | F-type conjugative transfer protein TrbC | - |
| QR684_RS23370 (48779) | 48779..49849 | - | 1071 | WP_000151575.1 | IncI1-type conjugal transfer protein TrbB | - |
| QR684_RS23375 (49868) | 49868..51076 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (51256) | 51256..51318 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (51256) | 51256..51318 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (51256) | 51256..51318 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (51256) | 51256..51318 | - | 63 | NuclAT_0 | - | Antitoxin |
| QR684_RS23380 (51368) | 51368..51520 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| QR684_RS23385 (51592) | 51592..51843 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| QR684_RS23390 (52204) | 52204..52986 | - | 783 | WP_001300609.1 | IS21-like element IS100kyp family helper ATPase IstB | - |
| QR684_RS23395 (52983) | 52983..54005 | - | 1023 | WP_001572805.1 | IS21-like element IS100 family transposase | - |
| - (54189) | 54189..54240 | - | 52 | NuclAT_1 | - | - |
| - (54189) | 54189..54240 | - | 52 | NuclAT_1 | - | - |
| - (54189) | 54189..54240 | - | 52 | NuclAT_1 | - | - |
| - (54189) | 54189..54240 | - | 52 | NuclAT_1 | - | - |
| QR684_RS23400 (54726) | 54726..54902 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| QR684_RS23405 (55294) | 55294..55503 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| QR684_RS23410 (55575) | 55575..56237 | - | 663 | WP_000644794.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCMY-2 | - | 1..101492 | 101492 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T284510 WP_001303307.1 NZ_CP128262:51368-51520 [Salmonella enterica subsp. enterica serovar Heidelberg]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT284510 NZ_CP128262:c51318-51256 [Salmonella enterica subsp. enterica serovar Heidelberg]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
