Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4567919..4568673 | Replicon | chromosome |
| Accession | NZ_CP128261 | ||
| Organism | Salmonella enterica subsp. enterica serovar Heidelberg isolate FT3-7B | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | QR684_RS22160 | Protein ID | WP_000558163.1 |
| Coordinates | 4567919..4568230 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QR684_RS22165 | Protein ID | WP_001259012.1 |
| Coordinates | 4568227..4568673 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QR684_RS22130 (4563577) | 4563577..4564479 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| QR684_RS22135 (4564476) | 4564476..4565111 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QR684_RS22140 (4565108) | 4565108..4566037 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| QR684_RS22145 (4566084) | 4566084..4566374 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| QR684_RS22150 (4566375) | 4566375..4566686 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| QR684_RS22155 (4566904) | 4566904..4567833 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| QR684_RS22160 (4567919) | 4567919..4568230 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QR684_RS22165 (4568227) | 4568227..4568673 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| QR684_RS22170 (4568688) | 4568688..4569629 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| QR684_RS22175 (4569674) | 4569674..4570111 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| QR684_RS22180 (4570108) | 4570108..4570980 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| QR684_RS22185 (4570974) | 4570974..4571573 | - | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| QR684_RS22190 (4571764) | 4571764..4572567 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| QR684_RS22195 (4572601) | 4572601..4573497 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T284507 WP_000558163.1 NZ_CP128261:4567919-4568230 [Salmonella enterica subsp. enterica serovar Heidelberg]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16750.08 Da Isoelectric Point: 6.6451
>AT284507 WP_001259012.1 NZ_CP128261:4568227-4568673 [Salmonella enterica subsp. enterica serovar Heidelberg]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|