Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 364243..364781 | Replicon | chromosome |
Accession | NZ_CP128261 | ||
Organism | Salmonella enterica subsp. enterica serovar Heidelberg isolate FT3-7B |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | A0A8E7RBX8 |
Locus tag | QR684_RS01660 | Protein ID | WP_001682450.1 |
Coordinates | 364506..364781 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A0A7U1KUN1 |
Locus tag | QR684_RS01655 | Protein ID | WP_000729714.1 |
Coordinates | 364243..364503 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR684_RS01640 (359954) | 359954..361507 | + | 1554 | WP_000013007.1 | TROVE domain-containing protein | - |
QR684_RS01645 (361855) | 361855..363069 | + | 1215 | WP_001105530.1 | RNA-splicing ligase RtcB | - |
QR684_RS01650 (363073) | 363073..364134 | + | 1062 | WP_000101032.1 | RNA 3'-terminal phosphate cyclase | - |
QR684_RS01655 (364243) | 364243..364503 | + | 261 | WP_000729714.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QR684_RS01660 (364506) | 364506..364781 | + | 276 | WP_001682450.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
QR684_RS01665 (364869) | 364869..367574 | - | 2706 | WP_001531645.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10605.16 Da Isoelectric Point: 8.9063
>T284493 WP_001682450.1 NZ_CP128261:364506-364781 [Salmonella enterica subsp. enterica serovar Heidelberg]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIGPDWILVDKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIGPDWILVDKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|