Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 6328262..6328853 | Replicon | chromosome |
Accession | NZ_CP128260 | ||
Organism | Pseudomonas fluorescens strain PH.SM |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QR290_RS28615 | Protein ID | WP_115079644.1 |
Coordinates | 6328575..6328853 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | QR290_RS28610 | Protein ID | WP_115079643.1 |
Coordinates | 6328262..6328567 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR290_RS28580 (QR290_28580) | 6323683..6324387 | + | 705 | WP_289204052.1 | HAD-IA family hydrolase | - |
QR290_RS28585 (QR290_28585) | 6324453..6324779 | - | 327 | WP_007951900.1 | transcriptional regulator SutA | - |
QR290_RS28590 (QR290_28590) | 6324882..6325307 | - | 426 | WP_039765261.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
QR290_RS28595 (QR290_28595) | 6325523..6326860 | - | 1338 | WP_007951904.1 | ammonium transporter | - |
QR290_RS28600 (QR290_28600) | 6326898..6327236 | - | 339 | WP_002555808.1 | P-II family nitrogen regulator | - |
QR290_RS28605 (QR290_28605) | 6327635..6327895 | + | 261 | WP_007920416.1 | accessory factor UbiK family protein | - |
QR290_RS28610 (QR290_28610) | 6328262..6328567 | - | 306 | WP_115079643.1 | HigA family addiction module antitoxin | Antitoxin |
QR290_RS28615 (QR290_28615) | 6328575..6328853 | - | 279 | WP_115079644.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QR290_RS28620 (QR290_28620) | 6329179..6330672 | + | 1494 | WP_085606079.1 | YifB family Mg chelatase-like AAA ATPase | - |
QR290_RS28625 (QR290_28625) | 6330778..6332754 | - | 1977 | WP_115079667.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10566.09 Da Isoelectric Point: 6.9493
>T284491 WP_115079644.1 NZ_CP128260:c6328853-6328575 [Pseudomonas fluorescens]
MIVSFRCSETEYLFRSGKTRFWSAILSVAERKLTMLDAAAVLADLRSPPGNRLETLEGDRKGQYSIRINAQWRICFVWGL
NGPEDVEIVDYH
MIVSFRCSETEYLFRSGKTRFWSAILSVAERKLTMLDAAAVLADLRSPPGNRLETLEGDRKGQYSIRINAQWRICFVWGL
NGPEDVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|