Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 4247089..4247744 | Replicon | chromosome |
Accession | NZ_CP128260 | ||
Organism | Pseudomonas fluorescens strain PH.SM |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QR290_RS18960 | Protein ID | WP_096822369.1 |
Coordinates | 4247089..4247433 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QR290_RS18965 | Protein ID | WP_115078473.1 |
Coordinates | 4247430..4247744 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR290_RS18945 (QR290_18945) | 4243184..4244716 | + | 1533 | WP_007951464.1 | NADH-quinone oxidoreductase subunit M | - |
QR290_RS18950 (QR290_18950) | 4244724..4246187 | + | 1464 | WP_011334964.1 | NADH-quinone oxidoreductase subunit NuoN | - |
QR290_RS18955 (QR290_18955) | 4246246..4246719 | - | 474 | WP_115078472.1 | GNAT family N-acetyltransferase | - |
QR290_RS18960 (QR290_18960) | 4247089..4247433 | + | 345 | WP_096822369.1 | toxin | Toxin |
QR290_RS18965 (QR290_18965) | 4247430..4247744 | + | 315 | WP_115078473.1 | transcriptional regulator | Antitoxin |
QR290_RS18970 (QR290_18970) | 4247905..4249230 | + | 1326 | WP_115078474.1 | OprD family porin | - |
QR290_RS18975 (QR290_18975) | 4249380..4249712 | - | 333 | WP_115078475.1 | DUF2790 domain-containing protein | - |
QR290_RS18980 (QR290_18980) | 4249792..4249992 | - | 201 | WP_115078476.1 | co-regulatory protein PtrA N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13569.38 Da Isoelectric Point: 6.9816
>T284489 WP_096822369.1 NZ_CP128260:4247089-4247433 [Pseudomonas fluorescens]
MDALFIELPAFQKHRDDYLDDDLFRSFQLELLKNPEAGDLIEGTGGLRKIRFCDQRRGKGKRSGLRVIYYWWSGFDQFWL
FTVYSKNEQDDLLPSQKRVFKQALDTEINTRTQI
MDALFIELPAFQKHRDDYLDDDLFRSFQLELLKNPEAGDLIEGTGGLRKIRFCDQRRGKGKRSGLRVIYYWWSGFDQFWL
FTVYSKNEQDDLLPSQKRVFKQALDTEINTRTQI
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|