Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 545741..546345 | Replicon | chromosome |
Accession | NZ_CP128260 | ||
Organism | Pseudomonas fluorescens strain PH.SM |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QR290_RS02405 | Protein ID | WP_115076186.1 |
Coordinates | 546031..546345 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QR290_RS02400 | Protein ID | WP_115076185.1 |
Coordinates | 545741..546028 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QR290_RS02385 (QR290_02385) | 541802..543343 | + | 1542 | WP_289204252.1 | phosphoenolpyruvate carboxykinase | - |
QR290_RS02390 (QR290_02390) | 543390..544031 | - | 642 | WP_162803799.1 | hypothetical protein | - |
QR290_RS02395 (QR290_02395) | 544028..544900 | - | 873 | WP_162803800.1 | hypothetical protein | - |
QR290_RS02400 (QR290_02400) | 545741..546028 | - | 288 | WP_115076185.1 | NadS family protein | Antitoxin |
QR290_RS02405 (QR290_02405) | 546031..546345 | - | 315 | WP_115076186.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QR290_RS02410 (QR290_02410) | 546457..546756 | - | 300 | WP_115076187.1 | hypothetical protein | - |
QR290_RS02415 (QR290_02415) | 547307..548434 | - | 1128 | WP_289204253.1 | hypothetical protein | - |
QR290_RS02420 (QR290_02420) | 548539..548820 | - | 282 | WP_205350838.1 | hypothetical protein | - |
QR290_RS02425 (QR290_02425) | 549125..549628 | + | 504 | WP_289204254.1 | polysaccharide deacetylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11833.73 Da Isoelectric Point: 10.3534
>T284484 WP_115076186.1 NZ_CP128260:c546345-546031 [Pseudomonas fluorescens]
MIFVETRIFTRRVKELLDDDTYAAFQKQLVVSPSIGDVIEGTGGIRKTRIAAKGHGKRGGARVIYYHFVSASQIGLLMIY
PKNEQHDLSSDERKALKVLIEKWR
MIFVETRIFTRRVKELLDDDTYAAFQKQLVVSPSIGDVIEGTGGIRKTRIAAKGHGKRGGARVIYYHFVSASQIGLLMIY
PKNEQHDLSSDERKALKVLIEKWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|