Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4975299..4975901 | Replicon | chromosome |
Accession | NZ_CP128255 | ||
Organism | Escherichia coli strain T309.Ta3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | QRX22_RS24355 | Protein ID | WP_000897302.1 |
Coordinates | 4975590..4975901 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QRX22_RS24350 | Protein ID | WP_000356397.1 |
Coordinates | 4975299..4975589 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRX22_RS24325 (4971372) | 4971372..4972274 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
QRX22_RS24330 (4972271) | 4972271..4972906 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
QRX22_RS24335 (4972903) | 4972903..4973832 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
QRX22_RS24340 (4974048) | 4974048..4974266 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
QRX22_RS24345 (4974662) | 4974662..4974940 | - | 279 | WP_001296612.1 | hypothetical protein | - |
QRX22_RS24350 (4975299) | 4975299..4975589 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
QRX22_RS24355 (4975590) | 4975590..4975901 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
QRX22_RS24360 (4976130) | 4976130..4977038 | + | 909 | WP_001331553.1 | alpha/beta hydrolase | - |
QRX22_RS24365 (4977102) | 4977102..4978043 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
QRX22_RS24370 (4978088) | 4978088..4978525 | - | 438 | WP_021531734.1 | D-aminoacyl-tRNA deacylase | - |
QRX22_RS24375 (4978522) | 4978522..4979394 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
QRX22_RS24380 (4979388) | 4979388..4979987 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T284479 WP_000897302.1 NZ_CP128255:c4975901-4975590 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|