Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 621377..622176 | Replicon | chromosome |
Accession | NZ_CP128255 | ||
Organism | Escherichia coli strain T309.Ta3 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | Q8FDB4 |
Locus tag | QRX22_RS03075 | Protein ID | WP_000347252.1 |
Coordinates | 621377..621841 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | QRX22_RS03080 | Protein ID | WP_001296435.1 |
Coordinates | 621841..622176 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRX22_RS03045 (616378) | 616378..616812 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QRX22_RS03050 (616830) | 616830..617708 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QRX22_RS03055 (617698) | 617698..618477 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QRX22_RS03060 (618488) | 618488..618961 | - | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QRX22_RS03065 (618984) | 618984..620264 | - | 1281 | WP_000681930.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QRX22_RS03070 (620513) | 620513..621322 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QRX22_RS03075 (621377) | 621377..621841 | - | 465 | WP_000347252.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QRX22_RS03080 (621841) | 621841..622176 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QRX22_RS03085 (622325) | 622325..623896 | - | 1572 | WP_021531624.1 | galactarate dehydratase | - |
QRX22_RS03090 (624271) | 624271..625605 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
QRX22_RS03095 (625621) | 625621..626391 | + | 771 | WP_033559498.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17750.11 Da Isoelectric Point: 9.4947
>T284460 WP_000347252.1 NZ_CP128255:c621841-621377 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|