Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2763519..2764312 | Replicon | chromosome |
Accession | NZ_CP128233 | ||
Organism | Paralcaligenes sp. CC-YST667 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | N7E01_RS15270 | Protein ID | WP_289173497.1 |
Coordinates | 2763845..2764312 (+) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | N7E01_RS15265 | Protein ID | WP_289173496.1 |
Coordinates | 2763519..2763848 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E01_RS15240 (N7E01_15240) | 2758822..2759208 | - | 387 | WP_289173492.1 | hypothetical protein | - |
N7E01_RS15245 (N7E01_15245) | 2759151..2760617 | - | 1467 | WP_289173493.1 | metallophosphoesterase | - |
N7E01_RS15250 (N7E01_15250) | 2761114..2762327 | + | 1214 | Protein_2999 | sulfatase-like hydrolase/transferase | - |
N7E01_RS15255 (N7E01_15255) | 2762389..2763060 | + | 672 | WP_289173494.1 | hypothetical protein | - |
N7E01_RS15260 (N7E01_15260) | 2763029..2763283 | + | 255 | WP_289173495.1 | dockerin type I domain-containing protein | - |
N7E01_RS15265 (N7E01_15265) | 2763519..2763848 | + | 330 | WP_289173496.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
N7E01_RS15270 (N7E01_15270) | 2763845..2764312 | + | 468 | WP_289173497.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
N7E01_RS15275 (N7E01_15275) | 2764428..2764862 | + | 435 | WP_289173498.1 | transposase | - |
N7E01_RS15280 (N7E01_15280) | 2764903..2765190 | + | 288 | WP_289173404.1 | IS66 family insertion sequence element accessory protein TnpB | - |
N7E01_RS15285 (N7E01_15285) | 2765339..2765500 | + | 162 | Protein_3006 | transposase | - |
N7E01_RS15290 (N7E01_15290) | 2765599..2766273 | + | 675 | WP_289173405.1 | IS66 family transposase | - |
N7E01_RS15295 (N7E01_15295) | 2766254..2766585 | + | 332 | Protein_3008 | transposase | - |
N7E01_RS15300 (N7E01_15300) | 2766661..2766837 | + | 177 | WP_289175826.1 | transposase domain-containing protein | - |
N7E01_RS15305 (N7E01_15305) | 2767329..2767571 | - | 243 | WP_289173499.1 | ATP-binding protein | - |
N7E01_RS15310 (N7E01_15310) | 2767674..2769038 | + | 1365 | Protein_3011 | IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2672837..2769058 | 96221 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17990.52 Da Isoelectric Point: 9.7079
>T284457 WP_289173497.1 NZ_CP128233:2763845-2764312 [Paralcaligenes sp. CC-YST667]
MSARKPEPLVIHGWTVFAHPLFLAQIEALVRQVESLKQKDPAGYVKKNASKRLAAITKLAFDVIPQDPTRPEYRQGGALG
DDHKHWFRAKFFQQYRLFFRYHAPSKVIVYAWVSDEDTKRAYESSDDAYRVFRKMLESGHPPDDWDQLLAEAVTK
MSARKPEPLVIHGWTVFAHPLFLAQIEALVRQVESLKQKDPAGYVKKNASKRLAAITKLAFDVIPQDPTRPEYRQGGALG
DDHKHWFRAKFFQQYRLFFRYHAPSKVIVYAWVSDEDTKRAYESSDDAYRVFRKMLESGHPPDDWDQLLAEAVTK
Download Length: 468 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 11781.23 Da Isoelectric Point: 4.5267
>AT284457 WP_289173496.1 NZ_CP128233:2763519-2763848 [Paralcaligenes sp. CC-YST667]
MAATLEVESTLTDRYQTTVPETVRRALKLGKRDKIHYTIHPSGDVVLTRVEASDGDDPVLGQFLAFLAADITRHPERLQA
VDAGLAQRLQALVGGVDVDLNAALSADDE
MAATLEVESTLTDRYQTTVPETVRRALKLGKRDKIHYTIHPSGDVVLTRVEASDGDDPVLGQFLAFLAADITRHPERLQA
VDAGLAQRLQALVGGVDVDLNAALSADDE
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|