Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 2622190..2622896 | Replicon | chromosome |
| Accession | NZ_CP128233 | ||
| Organism | Paralcaligenes sp. CC-YST667 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | N7E01_RS14445 | Protein ID | WP_289173378.1 |
| Coordinates | 2622594..2622896 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | - |
| Locus tag | N7E01_RS14440 | Protein ID | WP_289173377.1 |
| Coordinates | 2622190..2622591 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E01_RS14405 (N7E01_14405) | 2617241..2618043 | - | 803 | Protein_2832 | ABC transporter ATP-binding protein | - |
| N7E01_RS14410 (N7E01_14410) | 2618060..2618587 | - | 528 | WP_289173373.1 | hypothetical protein | - |
| N7E01_RS14415 (N7E01_14415) | 2618617..2619168 | - | 552 | WP_289173374.1 | acyl-CoA dehydrogenase family protein | - |
| N7E01_RS14420 (N7E01_14420) | 2619285..2619827 | - | 543 | WP_289173375.1 | carboxymuconolactone decarboxylase family protein | - |
| N7E01_RS14425 (N7E01_14425) | 2620050..2621178 | - | 1129 | Protein_2836 | aminotransferase class V-fold PLP-dependent enzyme | - |
| N7E01_RS14430 (N7E01_14430) | 2621345..2621619 | - | 275 | Protein_2837 | BrnA antitoxin family protein | - |
| N7E01_RS14435 (N7E01_14435) | 2621606..2621872 | - | 267 | WP_289173376.1 | BrnT family toxin | - |
| N7E01_RS14440 (N7E01_14440) | 2622190..2622591 | - | 402 | WP_289173377.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| N7E01_RS14445 (N7E01_14445) | 2622594..2622896 | - | 303 | WP_289173378.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| N7E01_RS14450 (N7E01_14450) | 2623117..2623836 | - | 720 | Protein_2841 | FAD-binding domain-containing protein | - |
| N7E01_RS14455 (N7E01_14455) | 2623937..2624173 | + | 237 | WP_289173379.1 | hypothetical protein | - |
| N7E01_RS14460 (N7E01_14460) | 2624212..2625612 | + | 1401 | WP_289173380.1 | pilus assembly protein | - |
| N7E01_RS14465 (N7E01_14465) | 2625906..2626172 | + | 267 | WP_289173381.1 | hypothetical protein | - |
| N7E01_RS14470 (N7E01_14470) | 2626257..2626811 | + | 555 | WP_289173382.1 | hypothetical protein | - |
| N7E01_RS14475 (N7E01_14475) | 2626829..2627809 | + | 981 | WP_289173383.1 | sensor domain-containing diguanylate cyclase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10977.68 Da Isoelectric Point: 8.9385
>T284455 WP_289173378.1 NZ_CP128233:c2622896-2622594 [Paralcaligenes sp. CC-YST667]
MEKGTPHRKLAVVKALVKTGHVKATASAFNGARELGINNLAGMCDVVLALTSSDFYKSMTTHADHRVWQDVYRAKTANGD
EVYVKLTVIDDVLIVSFKEL
MEKGTPHRKLAVVKALVKTGHVKATASAFNGARELGINNLAGMCDVVLALTSSDFYKSMTTHADHRVWQDVYRAKTANGD
EVYVKLTVIDDVLIVSFKEL
Download Length: 303 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14859.00 Da Isoelectric Point: 6.2264
>AT284455 WP_289173377.1 NZ_CP128233:c2622591-2622190 [Paralcaligenes sp. CC-YST667]
MKCPCCGAAELIHDTRDIPYTYKGEHTTIPAVTGDFCPACSEVVLTREDGDRYSEMVGLFQRQVNAAYVDPDYIAKVRKK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLALVKLLKLLDRHPDLLEEVRTA
MKCPCCGAAELIHDTRDIPYTYKGEHTTIPAVTGDFCPACSEVVLTREDGDRYSEMVGLFQRQVNAAYVDPDYIAKVRKK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLALVKLLKLLDRHPDLLEEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|