Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 956727..957327 | Replicon | chromosome |
Accession | NZ_CP128233 | ||
Organism | Paralcaligenes sp. CC-YST667 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N7E01_RS05035 | Protein ID | WP_128355399.1 |
Coordinates | 956727..957038 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N7E01_RS05040 | Protein ID | WP_128355400.1 |
Coordinates | 957040..957327 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E01_RS05015 (N7E01_05015) | 952505..953584 | - | 1080 | WP_289174830.1 | peptide chain release factor 1 | - |
N7E01_RS05020 (N7E01_05020) | 953673..954947 | - | 1275 | WP_289174831.1 | glutamyl-tRNA reductase | - |
N7E01_RS05030 (N7E01_05030) | 955410..956666 | + | 1257 | WP_289174832.1 | integrase arm-type DNA-binding domain-containing protein | - |
N7E01_RS05035 (N7E01_05035) | 956727..957038 | + | 312 | WP_128355399.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7E01_RS05040 (N7E01_05040) | 957040..957327 | + | 288 | WP_128355400.1 | NadS family protein | Antitoxin |
N7E01_RS05045 (N7E01_05045) | 957403..957693 | + | 291 | WP_128355401.1 | hypothetical protein | - |
N7E01_RS05050 (N7E01_05050) | 957745..958416 | + | 672 | WP_128355402.1 | TrbM/KikA/MpfK family conjugal transfer protein | - |
N7E01_RS05055 (N7E01_05055) | 958427..959092 | + | 666 | WP_128355403.1 | lytic transglycosylase domain-containing protein | - |
N7E01_RS05060 (N7E01_05060) | 959175..959495 | + | 321 | WP_128355404.1 | TrbC/VirB2 family protein | - |
N7E01_RS05065 (N7E01_05065) | 959499..959927 | + | 429 | WP_289174833.1 | VirB3 family type IV secretion system protein | - |
N7E01_RS05070 (N7E01_05070) | 959830..961476 | + | 1647 | WP_228255706.1 | hypothetical protein | - |
N7E01_RS05075 (N7E01_05075) | 961383..962273 | + | 891 | WP_289174834.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | dfrA12 / aadA2 / aac(6')-IIa / blaOXA-17 / qacE / floR / tet(G) / sul1 | - | 955353..1015847 | 60494 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11666.54 Da Isoelectric Point: 5.8505
>T284446 WP_128355399.1 NZ_CP128233:956727-957038 [Paralcaligenes sp. CC-YST667]
MEFIETPLFTRQIVDLLPDDDYAELQQILAANPRRGDLIPSGGGIRKVRHARPGMGKSGGIRVIYYWITAEDQIMMLLAY
PKSKQENLTPAQIEELRALVKDL
MEFIETPLFTRQIVDLLPDDDYAELQQILAANPRRGDLIPSGGGIRKVRHARPGMGKSGGIRVIYYWITAEDQIMMLLAY
PKSKQENLTPAQIEELRALVKDL
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|