Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 206811..207232 | Replicon | plasmid F |
| Accession | NZ_CP128219 | ||
| Organism | Escherichia coli strain TG1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QSI84_RS22860 | Protein ID | WP_096937776.1 |
| Coordinates | 206811..206936 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 207034..207232 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSI84_RS22825 (202526) | 202526..202897 | - | 372 | Protein_208 | conjugal transfer transcriptional regulator TraJ | - |
| QSI84_RS22830 (203084) | 203084..203467 | - | 384 | WP_001151527.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QSI84_RS22835 (203788) | 203788..204390 | + | 603 | WP_077763528.1 | transglycosylase SLT domain-containing protein | - |
| QSI84_RS22840 (204686) | 204686..205507 | - | 822 | WP_001234417.1 | DUF932 domain-containing protein | - |
| QSI84_RS22845 (205626) | 205626..205913 | - | 288 | WP_000107542.1 | hypothetical protein | - |
| QSI84_RS22850 (205938) | 205938..206144 | - | 207 | WP_000547965.1 | hypothetical protein | - |
| QSI84_RS22855 (206214) | 206214..206510 | + | 297 | Protein_214 | hypothetical protein | - |
| QSI84_RS22860 (206811) | 206811..206936 | - | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QSI84_RS22865 (206878) | 206878..207027 | - | 150 | Protein_216 | DUF5431 family protein | - |
| - (207034) | 207034..207232 | - | 199 | NuclAT_0 | - | Antitoxin |
| - (207034) | 207034..207232 | - | 199 | NuclAT_0 | - | Antitoxin |
| - (207034) | 207034..207232 | - | 199 | NuclAT_0 | - | Antitoxin |
| - (207034) | 207034..207232 | - | 199 | NuclAT_0 | - | Antitoxin |
| QSI84_RS22870 (207201) | 207201..207963 | - | 763 | Protein_217 | plasmid SOS inhibition protein A | - |
| QSI84_RS22875 (207960) | 207960..208394 | - | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
| QSI84_RS22880 (208449) | 208449..210407 | - | 1959 | WP_000117173.1 | ParB/RepB/Spo0J family partition protein | - |
| QSI84_RS22885 (210473) | 210473..210706 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| QSI84_RS22890 (210763) | 210763..211302 | - | 540 | WP_000290801.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 1..232324 | 232324 | |
| - | flank | IS/Tn | - | - | 201773..202276 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T284439 WP_096937776.1 NZ_CP128219:c206936-206811 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 199 bp
>AT284439 NZ_CP128219:c207232-207034 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
