Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 99371..100065 Replicon plasmid F
Accession NZ_CP128219
Organism Escherichia coli strain TG1

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag QSI84_RS22300 Protein ID WP_001263489.1
Coordinates 99371..99769 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag QSI84_RS22305 Protein ID WP_000554758.1
Coordinates 99772..100065 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (94959) 94959..95039 - 81 NuclAT_1 - -
- (94959) 94959..95039 - 81 NuclAT_1 - -
- (94959) 94959..95039 - 81 NuclAT_1 - -
- (94959) 94959..95039 - 81 NuclAT_1 - -
QSI84_RS22275 (95635) 95635..96093 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
QSI84_RS22280 (96354) 96354..97811 + 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
QSI84_RS22285 (97868) 97868..98389 - 522 Protein_100 peptide chain release factor H -
QSI84_RS22290 (98385) 98385..98591 - 207 Protein_101 RtcB family protein -
QSI84_RS22295 (98909) 98909..99361 - 453 WP_001059892.1 GNAT family N-acetyltransferase -
QSI84_RS22300 (99371) 99371..99769 - 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QSI84_RS22305 (99772) 99772..100065 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QSI84_RS22310 (100117) 100117..101172 - 1056 WP_001226164.1 DNA polymerase IV -
QSI84_RS22315 (101243) 101243..102028 - 786 WP_000207552.1 putative lateral flagellar export/assembly protein LafU -
QSI84_RS22320 (102000) 102000..103712 + 1713 Protein_107 flagellar biosynthesis protein FlhA -
QSI84_RS22325 (103936) 103936..104433 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 1..232324 232324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T284436 WP_001263489.1 NZ_CP128219:c99769-99371 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT284436 WP_000554758.1 NZ_CP128219:c100065-99772 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References