Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 34546..34800 | Replicon | plasmid F |
| Accession | NZ_CP128219 | ||
| Organism | Escherichia coli strain TG1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QSI84_RS21900 | Protein ID | WP_001312851.1 |
| Coordinates | 34546..34695 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 34739..34800 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSI84_RS21880 (30655) | 30655..31206 | + | 552 | WP_001235704.1 | recombinase family protein | - |
| QSI84_RS21885 (31222) | 31222..33318 | + | 2097 | WP_000422420.1 | hypothetical protein | - |
| QSI84_RS21890 (33697) | 33697..33771 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| QSI84_RS21895 (34005) | 34005..34262 | - | 258 | WP_000083834.1 | replication regulatory protein RepA | - |
| QSI84_RS21900 (34546) | 34546..34695 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (34739) | 34739..34800 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (34739) | 34739..34800 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (34739) | 34739..34800 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (34739) | 34739..34800 | + | 62 | NuclAT_2 | - | Antitoxin |
| QSI84_RS21905 (35096) | 35096..35407 | + | 312 | WP_000802277.1 | hypothetical protein | - |
| QSI84_RS21910 (35588) | 35588..35674 | - | 87 | Protein_26 | endonuclease | - |
| QSI84_RS21915 (35872) | 35872..36060 | - | 189 | WP_001345829.1 | hypothetical protein | - |
| QSI84_RS21920 (36195) | 36195..36362 | - | 168 | Protein_28 | ProQ/FINO family protein | - |
| QSI84_RS21930 (37614) | 37614..38489 | - | 876 | Protein_30 | inverse autotransporter beta domain-containing protein | - |
| QSI84_RS21935 (39041) | 39041..39130 | + | 90 | Protein_31 | hypothetical protein | - |
| QSI84_RS21940 (39604) | 39604..39705 | + | 102 | WP_000662258.1 | small membrane protein YkgR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 1..232324 | 232324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T284434 WP_001312851.1 NZ_CP128219:c34695-34546 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT284434 NZ_CP128219:34739-34800 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
