Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 34546..34800 Replicon plasmid F
Accession NZ_CP128219
Organism Escherichia coli strain TG1

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag QSI84_RS21900 Protein ID WP_001312851.1
Coordinates 34546..34695 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 34739..34800 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSI84_RS21880 (30655) 30655..31206 + 552 WP_001235704.1 recombinase family protein -
QSI84_RS21885 (31222) 31222..33318 + 2097 WP_000422420.1 hypothetical protein -
QSI84_RS21890 (33697) 33697..33771 - 75 WP_001442103.1 RepA leader peptide Tap -
QSI84_RS21895 (34005) 34005..34262 - 258 WP_000083834.1 replication regulatory protein RepA -
QSI84_RS21900 (34546) 34546..34695 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (34739) 34739..34800 + 62 NuclAT_2 - Antitoxin
- (34739) 34739..34800 + 62 NuclAT_2 - Antitoxin
- (34739) 34739..34800 + 62 NuclAT_2 - Antitoxin
- (34739) 34739..34800 + 62 NuclAT_2 - Antitoxin
QSI84_RS21905 (35096) 35096..35407 + 312 WP_000802277.1 hypothetical protein -
QSI84_RS21910 (35588) 35588..35674 - 87 Protein_26 endonuclease -
QSI84_RS21915 (35872) 35872..36060 - 189 WP_001345829.1 hypothetical protein -
QSI84_RS21920 (36195) 36195..36362 - 168 Protein_28 ProQ/FINO family protein -
QSI84_RS21930 (37614) 37614..38489 - 876 Protein_30 inverse autotransporter beta domain-containing protein -
QSI84_RS21935 (39041) 39041..39130 + 90 Protein_31 hypothetical protein -
QSI84_RS21940 (39604) 39604..39705 + 102 WP_000662258.1 small membrane protein YkgR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE 1..232324 232324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T284434 WP_001312851.1 NZ_CP128219:c34695-34546 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT284434 NZ_CP128219:34739-34800 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References