Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 72925..73178 Replicon plasmid pKPC_KP0714
Accession NZ_CP128193
Organism Klebsiella pneumoniae strain KP0714

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag QSG82_RS29185 Protein ID WP_001312851.1
Coordinates 73029..73178 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 72925..72984 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSG82_RS29145 (68585) 68585..68650 - 66 Protein_92 helix-turn-helix domain-containing protein -
QSG82_RS29150 (68703) 68703..69407 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
QSG82_RS29155 (69432) 69432..69632 + 201 WP_072354025.1 hypothetical protein -
QSG82_RS29160 (69652) 69652..70398 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
QSG82_RS29165 (70453) 70453..71013 + 561 WP_000139328.1 fertility inhibition protein FinO -
QSG82_RS29170 (71145) 71145..71345 + 201 WP_015059022.1 hypothetical protein -
QSG82_RS29175 (71731) 71731..72330 + 600 WP_032083981.1 PIN domain-containing protein -
QSG82_RS29180 (72392) 72392..72724 + 333 WP_152916585.1 hypothetical protein -
- (72925) 72925..72984 - 60 NuclAT_1 - Antitoxin
- (72925) 72925..72984 - 60 NuclAT_1 - Antitoxin
- (72925) 72925..72984 - 60 NuclAT_1 - Antitoxin
- (72925) 72925..72984 - 60 NuclAT_1 - Antitoxin
QSG82_RS29185 (73029) 73029..73178 + 150 WP_001312851.1 Hok/Gef family protein Toxin
QSG82_RS29190 (73462) 73462..73710 + 249 WP_000083837.1 replication regulatory protein RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid fosA3 / blaTEM-1B / rmtB / blaKPC-2 - 1..74021 74021


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T284396 WP_001312851.1 NZ_CP128193:73029-73178 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT284396 NZ_CP128193:c72984-72925 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References