Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 32293..32562 | Replicon | plasmid pKPC_KP0714 |
| Accession | NZ_CP128193 | ||
| Organism | Klebsiella pneumoniae strain KP0714 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QSG82_RS28905 | Protein ID | WP_001372321.1 |
| Coordinates | 32437..32562 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 32293..32358 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSG82_RS28875 | 28003..28530 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| QSG82_RS28880 | 28588..28821 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| QSG82_RS28885 | 28882..30905 | + | 2024 | Protein_40 | ParB/RepB/Spo0J family partition protein | - |
| QSG82_RS28890 | 30974..31408 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| QSG82_RS28895 | 31405..32124 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 32136..32360 | + | 225 | NuclAT_0 | - | - |
| - | 32136..32360 | + | 225 | NuclAT_0 | - | - |
| - | 32136..32360 | + | 225 | NuclAT_0 | - | - |
| - | 32136..32360 | + | 225 | NuclAT_0 | - | - |
| - | 32293..32358 | - | 66 | - | - | Antitoxin |
| QSG82_RS28900 | 32346..32495 | + | 150 | Protein_43 | plasmid maintenance protein Mok | - |
| QSG82_RS28905 | 32437..32562 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QSG82_RS28910 | 32881..33177 | - | 297 | Protein_45 | hypothetical protein | - |
| QSG82_RS28915 | 33477..33734 | + | 258 | WP_137952642.1 | hypothetical protein | - |
| QSG82_RS28920 | 33781..34485 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| QSG82_RS28925 | 34538..35041 | + | 504 | Protein_48 | transposase | - |
| QSG82_RS28930 | 35291..36172 | - | 882 | WP_004199234.1 | carbapenem-hydrolyzing class A beta-lactamase KPC-2 | - |
| QSG82_RS28935 | 36448..37428 | - | 981 | WP_013213985.1 | IS481-like element ISKpn27 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | fosA3 / blaTEM-1B / rmtB / blaKPC-2 | - | 1..74021 | 74021 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T284394 WP_001372321.1 NZ_CP128193:32437-32562 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT284394 NZ_CP128193:c32358-32293 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|