Detailed information of TA system TA284394

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 32293..32562
• Replicon: plasmid pKPC_KP0714
• Accession: NZ_CP128193
• Organism: Klebsiella pneumoniae strain KP0714

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QSG82_RS28905
• Protein ID: WP_001372321.1
• Coordinates: 32437..32562 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	32293..32358 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QSG82_RS28875	28003..28530	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
QSG82_RS28880	28588..28821	+	234	WP_000006003.1	DUF905 family protein	-
QSG82_RS28885	28882..30905	+	2024	Protein_40	ParB/RepB/Spo0J family partition protein	-
QSG82_RS28890	30974..31408	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QSG82_RS28895	31405..32124	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	32136..32360	+	225	NuclAT_0	-	-
-	32136..32360	+	225	NuclAT_0	-	-
-	32136..32360	+	225	NuclAT_0	-	-
-	32136..32360	+	225	NuclAT_0	-	-
-	32293..32358	-	66	-	-	Antitoxin
QSG82_RS28900	32346..32495	+	150	Protein_43	plasmid maintenance protein Mok	-
QSG82_RS28905	32437..32562	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QSG82_RS28910	32881..33177	-	297	Protein_45	hypothetical protein	-
QSG82_RS28915	33477..33734	+	258	WP_137952642.1	hypothetical protein	-
QSG82_RS28920	33781..34485	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
QSG82_RS28925	34538..35041	+	504	Protein_48	transposase	-
QSG82_RS28930	35291..36172	-	882	WP_004199234.1	carbapenem-hydrolyzing class A beta-lactamase KPC-2	-
QSG82_RS28935	36448..37428	-	981	WP_013213985.1	IS481-like element ISKpn27 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	fosA3 / blaTEM-1B / rmtB / blaKPC-2	-	1..74021	74021

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T284394 WP_001372321.1 NZ_CP128193:32437-32562 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT284394 NZ_CP128193:c32358-32293 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin