Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 46288..47015 | Replicon | plasmid pVir_KP0714 |
Accession | NZ_CP128192 | ||
Organism | Klebsiella pneumoniae strain KP0714 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A5Q9LNL2 |
Locus tag | QSG82_RS27520 | Protein ID | WP_004118600.1 |
Coordinates | 46288..46599 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | V0AHC4 |
Locus tag | QSG82_RS27525 | Protein ID | WP_000990392.1 |
Coordinates | 46596..47015 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSG82_RS27500 (QSG82_27500) | 42802..43521 | + | 720 | WP_001102107.1 | (Fe-S)-binding protein | - |
QSG82_RS27505 (QSG82_27505) | 43532..44959 | + | 1428 | WP_000023895.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
QSG82_RS27510 (QSG82_27510) | 44952..45647 | + | 696 | WP_004118595.1 | lactate utilization protein C | - |
QSG82_RS27515 (QSG82_27515) | 45697..46077 | - | 381 | Protein_47 | gluconate permease | - |
QSG82_RS27520 (QSG82_27520) | 46288..46599 | + | 312 | WP_004118600.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
QSG82_RS27525 (QSG82_27525) | 46596..47015 | + | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
QSG82_RS27530 (QSG82_27530) | 47052..48254 | - | 1203 | WP_003031541.1 | hypothetical protein | - |
QSG82_RS27535 (QSG82_27535) | 48247..48576 | - | 330 | WP_004118613.1 | hypothetical protein | - |
QSG82_RS27540 (QSG82_27540) | 48573..49232 | - | 660 | WP_000078540.1 | hypothetical protein | - |
QSG82_RS27545 (QSG82_27545) | 49656..50012 | - | 357 | WP_077253206.1 | Ref family recombination enhancement nuclease | - |
QSG82_RS27550 (QSG82_27550) | 50132..50272 | - | 141 | WP_004118614.1 | hypothetical protein | - |
QSG82_RS27555 (QSG82_27555) | 50565..50918 | + | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
QSG82_RS27560 (QSG82_27560) | 50966..51328 | + | 363 | WP_020324593.1 | arsenite efflux transporter metallochaperone ArsD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 | rmpA / iutA / iucD / iucC / iucB / iucA | 1..254123 | 254123 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12386.14 Da Isoelectric Point: 10.0935
>T284389 WP_004118600.1 NZ_CP128192:46288-46599 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT284389 WP_000990392.1 NZ_CP128192:46596-47015 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Q9LNL2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AHC4 |