Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 795565..796340 | Replicon | chromosome |
Accession | NZ_CP128191 | ||
Organism | Klebsiella pneumoniae strain KP0714 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | QSG82_RS04065 | Protein ID | WP_004150910.1 |
Coordinates | 795855..796340 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | QSG82_RS04060 | Protein ID | WP_004150912.1 |
Coordinates | 795565..795858 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSG82_RS04040 (QSG82_04040) | 790773..791375 | - | 603 | WP_062954968.1 | short chain dehydrogenase | - |
QSG82_RS04045 (QSG82_04045) | 791473..792384 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
QSG82_RS04050 (QSG82_04050) | 792385..793533 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
QSG82_RS04055 (QSG82_04055) | 793544..794920 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
QSG82_RS04060 (QSG82_04060) | 795565..795858 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
QSG82_RS04065 (QSG82_04065) | 795855..796340 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
QSG82_RS04070 (QSG82_04070) | 797044..797637 | + | 594 | WP_004188553.1 | hypothetical protein | - |
QSG82_RS04075 (QSG82_04075) | 797734..797950 | + | 217 | Protein_803 | transposase | - |
QSG82_RS04080 (QSG82_04080) | 798556..799428 | + | 873 | WP_004188557.1 | ParA family protein | - |
QSG82_RS04085 (QSG82_04085) | 799428..799811 | + | 384 | WP_004150906.1 | hypothetical protein | - |
QSG82_RS04090 (QSG82_04090) | 799804..801171 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 797734..797886 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T284377 WP_004150910.1 NZ_CP128191:795855-796340 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |