284375

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 363593..364179 Replicon chromosome
Accession NZ_CP128191
Organism Klebsiella pneumoniae strain KP0714

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QSG82_RS01775 Protein ID WP_002920800.1
Coordinates 363811..364179 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag QSG82_RS01770 Protein ID WP_002920802.1
Coordinates 363593..363814 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSG82_RS01750 (QSG82_01750) 359750..360676 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QSG82_RS01755 (QSG82_01755) 360673..361950 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
QSG82_RS01760 (QSG82_01760) 361947..362714 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QSG82_RS01765 (QSG82_01765) 362716..363429 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QSG82_RS01770 (QSG82_01770) 363593..363814 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QSG82_RS01775 (QSG82_01775) 363811..364179 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QSG82_RS01780 (QSG82_01780) 364452..365768 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QSG82_RS01785 (QSG82_01785) 365875..366762 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QSG82_RS01790 (QSG82_01790) 366759..367604 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QSG82_RS01795 (QSG82_01795) 367606..368676 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 360673..369413 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T284375 WP_002920800.1 NZ_CP128191:363811-364179 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT284375 WP_002920802.1 NZ_CP128191:363593-363814 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References