Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 1610405..1610919 | Replicon | chromosome |
Accession | NZ_CP128169 | ||
Organism | Limosilactobacillus fermentum strain RC4 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | QSU93_RS08255 | Protein ID | WP_286102252.1 |
Coordinates | 1610405..1610668 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | QSU93_RS08260 | Protein ID | WP_100352120.1 |
Coordinates | 1610665..1610919 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSU93_RS08235 (QSU93_08235) | 1605744..1606610 | - | 867 | WP_286102249.1 | Gfo/Idh/MocA family oxidoreductase | - |
QSU93_RS08240 (QSU93_08240) | 1606568..1606783 | - | 216 | WP_286102250.1 | hypothetical protein | - |
QSU93_RS08245 (QSU93_08245) | 1607447..1608361 | + | 915 | WP_286102251.1 | hypothetical protein | - |
QSU93_RS08250 (QSU93_08250) | 1608874..1609995 | + | 1122 | WP_205303642.1 | PTS sugar transporter subunit IIC | - |
QSU93_RS08255 (QSU93_08255) | 1610405..1610668 | - | 264 | WP_286102252.1 | Txe/YoeB family addiction module toxin | Toxin |
QSU93_RS08260 (QSU93_08260) | 1610665..1610919 | - | 255 | WP_100352120.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QSU93_RS08265 (QSU93_08265) | 1611104..1611732 | - | 629 | Protein_1582 | family 1 glycosylhydrolase | - |
QSU93_RS08270 (QSU93_08270) | 1611983..1612642 | - | 660 | WP_286102253.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
QSU93_RS08275 (QSU93_08275) | 1613036..1614322 | - | 1287 | WP_286102254.1 | ISL3 family transposase | - |
QSU93_RS08280 (QSU93_08280) | 1614413..1615399 | - | 987 | WP_286102255.1 | IS30 family transposase | - |
QSU93_RS08285 (QSU93_08285) | 1615633..1615782 | + | 150 | Protein_1586 | IS5/IS1182 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10315.01 Da Isoelectric Point: 10.3042
>T284367 WP_286102252.1 NZ_CP128169:c1610668-1610405 [Limosilactobacillus fermentum]
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDTLAPNQGFEKLVPPIKGFYSRRINIQYRLVYKVDQDTQTVIIY
SAWSHYE
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDTLAPNQGFEKLVPPIKGFYSRRINIQYRLVYKVDQDTQTVIIY
SAWSHYE
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|