Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3320226..3320886 | Replicon | chromosome |
Accession | NZ_CP127881 | ||
Organism | Serratia marcescens strain ELP1.10 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QRD25_RS15890 | Protein ID | WP_031300708.1 |
Coordinates | 3320533..3320886 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QRD25_RS15885 | Protein ID | WP_049186895.1 |
Coordinates | 3320226..3320528 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRD25_RS15860 (QRD25_15865) | 3315606..3316334 | - | 729 | WP_239664295.1 | SDR family oxidoreductase | - |
QRD25_RS15865 (QRD25_15870) | 3316377..3317012 | - | 636 | WP_004935489.1 | SDR family oxidoreductase | - |
QRD25_RS15870 (QRD25_15875) | 3317028..3317963 | - | 936 | WP_049187877.1 | alpha/beta hydrolase | - |
QRD25_RS15875 (QRD25_15880) | 3317963..3318883 | - | 921 | WP_031300707.1 | alpha/beta hydrolase | - |
QRD25_RS15880 (QRD25_15885) | 3319022..3319930 | + | 909 | WP_004935498.1 | LysR family transcriptional regulator | - |
QRD25_RS15885 (QRD25_15890) | 3320226..3320528 | - | 303 | WP_049186895.1 | XRE family transcriptional regulator | Antitoxin |
QRD25_RS15890 (QRD25_15895) | 3320533..3320886 | - | 354 | WP_031300708.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRD25_RS15895 (QRD25_15900) | 3321325..3322620 | + | 1296 | WP_197753346.1 | tricarballylate/proton symporter TcuC | - |
QRD25_RS15900 (QRD25_15905) | 3322647..3323453 | + | 807 | WP_049186899.1 | substrate-binding domain-containing protein | - |
QRD25_RS15905 (QRD25_15910) | 3323428..3324327 | - | 900 | WP_286093451.1 | LysR family transcriptional regulator | - |
QRD25_RS15910 (QRD25_15915) | 3324431..3324796 | - | 366 | WP_004935528.1 | diacylglycerol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3314037..3339594 | 25557 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13609.61 Da Isoelectric Point: 9.0493
>T284339 WP_031300708.1 NZ_CP127881:c3320886-3320533 [Serratia marcescens]
VWEIKTTDAFDHWFRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGM
VLCAGNKAGDEKRFYDRMLQIADREFTNWLNTLKEKE
VWEIKTTDAFDHWFRSLSDADRACVLAALMVLREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGM
VLCAGNKAGDEKRFYDRMLQIADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|