Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 4946726..4947330 | Replicon | chromosome |
| Accession | NZ_CP127872 | ||
| Organism | Pseudomonas asiatica strain RYYT.1b | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A1L5PVG8 |
| Locus tag | QQ994_RS22300 | Protein ID | WP_075046186.1 |
| Coordinates | 4946726..4947046 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1L5PVK4 |
| Locus tag | QQ994_RS22305 | Protein ID | WP_075046187.1 |
| Coordinates | 4947043..4947330 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ994_RS22275 (QQ994_22275) | 4942232..4942444 | + | 213 | WP_015271611.1 | cysteine-rich CWC family protein | - |
| QQ994_RS22280 (QQ994_22280) | 4942454..4943146 | + | 693 | WP_075046183.1 | pseudouridine synthase | - |
| QQ994_RS22285 (QQ994_22285) | 4943595..4944482 | + | 888 | WP_075046184.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
| QQ994_RS22295 (QQ994_22295) | 4944832..4946538 | + | 1707 | WP_075046185.1 | SulP family inorganic anion transporter | - |
| QQ994_RS22300 (QQ994_22300) | 4946726..4947046 | + | 321 | WP_075046186.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQ994_RS22305 (QQ994_22305) | 4947043..4947330 | + | 288 | WP_075046187.1 | NadS family protein | Antitoxin |
| QQ994_RS22310 (QQ994_22310) | 4947413..4948480 | - | 1068 | WP_286100490.1 | glycerophosphodiester phosphodiesterase family protein | - |
| QQ994_RS22315 (QQ994_22315) | 4948720..4949730 | + | 1011 | WP_075046189.1 | DUF4917 family protein | - |
| QQ994_RS22320 (QQ994_22320) | 4949883..4950926 | - | 1044 | WP_075046190.1 | tetratricopeptide repeat protein | - |
| QQ994_RS22325 (QQ994_22325) | 4950928..4951896 | - | 969 | WP_075047036.1 | type II secretion system F family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12232.08 Da Isoelectric Point: 10.1916
>T284318 WP_075046186.1 NZ_CP127872:4946726-4947046 [Pseudomonas asiatica]
MLFTETTLFTKRVRELLDDDTYRLLQVRLMASPETGDLIEGTGGLRKIRVPANGHGKRGGARVIYYHFISRSQIAMLYIY
GKNEQPDLSSEQRKALKSIIEHWRHA
MLFTETTLFTKRVRELLDDDTYRLLQVRLMASPETGDLIEGTGGLRKIRVPANGHGKRGGARVIYYHFISRSQIAMLYIY
GKNEQPDLSSEQRKALKSIIEHWRHA
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L5PVG8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L5PVK4 |