Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 29141..29405 | Replicon | plasmid pMB7671_5 |
| Accession | NZ_CP127853 | ||
| Organism | Escherichia coli strain MB7671 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | PJZ59_RS24525 | Protein ID | WP_001387489.1 |
| Coordinates | 29141..29293 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 29345..29405 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJZ59_RS24485 (24233) | 24233..24766 | - | 534 | WP_001221666.1 | lipocalin family protein | - |
| PJZ59_RS24490 (24860) | 24860..26005 | - | 1146 | WP_274293082.1 | class C beta-lactamase CMY-185 | - |
| PJZ59_RS24500 (27210) | 27210..27308 | + | 99 | Protein_27 | ethanolamine utilization protein EutE | - |
| PJZ59_RS24505 (27380) | 27380..27589 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| PJZ59_RS24510 (27873) | 27873..28157 | + | 285 | WP_001707309.1 | hypothetical protein | - |
| PJZ59_RS24515 (28222) | 28222..28317 | - | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| PJZ59_RS24520 (28818) | 28818..29069 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| PJZ59_RS24525 (29141) | 29141..29293 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - (29345) | 29345..29405 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (29345) | 29345..29405 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (29345) | 29345..29405 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (29345) | 29345..29405 | + | 61 | NuclAT_0 | - | Antitoxin |
| PJZ59_RS24530 (29614) | 29614..29988 | + | 375 | WP_223349261.1 | hypothetical protein | - |
| PJZ59_RS24535 (30141) | 30141..31298 | + | 1158 | Protein_34 | IS1380-like element ISEcp1 family transposase | - |
| PJZ59_RS24540 (31354) | 31354..32051 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
| PJZ59_RS24545 (32062) | 32062..32370 | - | 309 | WP_039023235.1 | transcription termination/antitermination NusG family protein | - |
| PJZ59_RS24550 (32812) | 32812..33099 | - | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
| PJZ59_RS24555 (33137) | 33137..33295 | - | 159 | Protein_38 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCMY-42 | - | 1..34280 | 34280 | |
| - | inside | IScluster/Tn | blaCMY-42 | - | 24860..31629 | 6769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T284297 WP_001387489.1 NZ_CP127853:c29293-29141 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT284297 NZ_CP127853:29345-29405 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
