Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 60665..60918 | Replicon | plasmid pMB7671_3 |
| Accession | NZ_CP127851 | ||
| Organism | Escherichia coli strain MB7671 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PJZ59_RS24035 | Protein ID | WP_001312851.1 |
| Coordinates | 60769..60918 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 60665..60724 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJZ59_RS24000 (56441) | 56441..57301 | + | 861 | WP_000704523.1 | alpha/beta hydrolase | - |
| PJZ59_RS24005 (57404) | 57404..57964 | + | 561 | WP_000139321.1 | fertility inhibition protein FinO | - |
| PJZ59_RS24010 (58093) | 58093..58305 | + | 213 | WP_001309245.1 | ANR family transcriptional regulator | - |
| PJZ59_RS24015 (58550) | 58550..59011 | + | 462 | WP_001233838.1 | thermonuclease family protein | - |
| PJZ59_RS24020 (59057) | 59057..59266 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| PJZ59_RS24025 (59304) | 59304..59894 | + | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| PJZ59_RS24030 (60049) | 60049..60522 | + | 474 | WP_187810334.1 | hypothetical protein | - |
| - (60665) | 60665..60724 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (60665) | 60665..60724 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (60665) | 60665..60724 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (60665) | 60665..60724 | - | 60 | NuclAT_0 | - | Antitoxin |
| PJZ59_RS24035 (60769) | 60769..60918 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| PJZ59_RS24040 (61203) | 61203..61451 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| PJZ59_RS24045 (61566) | 61566..61750 | + | 185 | Protein_82 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..61762 | 61762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T284295 WP_001312851.1 NZ_CP127851:60769-60918 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT284295 NZ_CP127851:c60724-60665 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|