Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 60665..60918 Replicon plasmid pMB7671_3
Accession NZ_CP127851
Organism Escherichia coli strain MB7671

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag PJZ59_RS24035 Protein ID WP_001312851.1
Coordinates 60769..60918 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 60665..60724 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PJZ59_RS24000 (56441) 56441..57301 + 861 WP_000704523.1 alpha/beta hydrolase -
PJZ59_RS24005 (57404) 57404..57964 + 561 WP_000139321.1 fertility inhibition protein FinO -
PJZ59_RS24010 (58093) 58093..58305 + 213 WP_001309245.1 ANR family transcriptional regulator -
PJZ59_RS24015 (58550) 58550..59011 + 462 WP_001233838.1 thermonuclease family protein -
PJZ59_RS24020 (59057) 59057..59266 + 210 WP_001298565.1 hemolysin expression modulator Hha -
PJZ59_RS24025 (59304) 59304..59894 + 591 WP_033807967.1 DUF2726 domain-containing protein -
PJZ59_RS24030 (60049) 60049..60522 + 474 WP_187810334.1 hypothetical protein -
- (60665) 60665..60724 - 60 NuclAT_0 - Antitoxin
- (60665) 60665..60724 - 60 NuclAT_0 - Antitoxin
- (60665) 60665..60724 - 60 NuclAT_0 - Antitoxin
- (60665) 60665..60724 - 60 NuclAT_0 - Antitoxin
PJZ59_RS24035 (60769) 60769..60918 + 150 WP_001312851.1 Hok/Gef family protein Toxin
PJZ59_RS24040 (61203) 61203..61451 + 249 WP_000083839.1 replication regulatory protein RepA -
PJZ59_RS24045 (61566) 61566..61750 + 185 Protein_82 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..61762 61762


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T284295 WP_001312851.1 NZ_CP127851:60769-60918 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT284295 NZ_CP127851:c60724-60665 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References