Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3904535..3905132 | Replicon | chromosome |
| Accession | NZ_CP127839 | ||
| Organism | Klebsiella pneumoniae RYC492 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A9J6S5A1 |
| Locus tag | QRF73_RS19015 | Protein ID | WP_004893639.1 |
| Coordinates | 3904815..3905132 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | QRF73_RS19010 | Protein ID | WP_004142561.1 |
| Coordinates | 3904535..3904822 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF73_RS18980 (QRF73_18975) | 3900615..3900863 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| QRF73_RS18985 (QRF73_18980) | 3900881..3901222 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| QRF73_RS18990 (QRF73_18985) | 3901253..3902368 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| QRF73_RS18995 (QRF73_18990) | 3902548..3903129 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| QRF73_RS19000 (QRF73_18995) | 3903129..3903497 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| QRF73_RS19005 (QRF73_19000) | 3903617..3904270 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| QRF73_RS19010 (QRF73_19005) | 3904535..3904822 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QRF73_RS19015 (QRF73_19010) | 3904815..3905132 | - | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRF73_RS19020 (QRF73_19015) | 3905317..3906360 | - | 1044 | WP_004893645.1 | DUF2157 domain-containing protein | - |
| QRF73_RS19025 (QRF73_19020) | 3907026..3907892 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| QRF73_RS19030 (QRF73_19025) | 3908001..3909428 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T284266 WP_004893639.1 NZ_CP127839:c3905132-3904815 [Klebsiella pneumoniae RYC492]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|