Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 2362544..2363131 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | QQ658_RS10880 | Protein ID | WP_286024872.1 |
| Coordinates | 2362544..2362825 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QQ658_RS10885 | Protein ID | WP_286024873.1 |
| Coordinates | 2362835..2363131 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS10860 (QQ658_10860) | 2358261..2359358 | + | 1098 | WP_286024868.1 | phosphate ABC transporter substrate-binding protein PstS | - |
| QQ658_RS10865 (QQ658_10865) | 2359488..2360486 | + | 999 | WP_286024869.1 | phosphate ABC transporter permease subunit PstC | - |
| QQ658_RS10870 (QQ658_10870) | 2360483..2361604 | + | 1122 | WP_286024870.1 | phosphate ABC transporter permease PstA | - |
| QQ658_RS10875 (QQ658_10875) | 2361690..2362469 | + | 780 | WP_286024871.1 | phosphate ABC transporter ATP-binding protein PstB | - |
| QQ658_RS10880 (QQ658_10880) | 2362544..2362825 | + | 282 | WP_286024872.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQ658_RS10885 (QQ658_10885) | 2362835..2363131 | + | 297 | WP_286024873.1 | HigA family addiction module antitoxin | Antitoxin |
| QQ658_RS10890 (QQ658_10890) | 2363189..2363926 | + | 738 | WP_286024874.1 | glycerophosphodiester phosphodiesterase family protein | - |
| QQ658_RS10895 (QQ658_10895) | 2364040..2364696 | + | 657 | WP_286024875.1 | hypothetical protein | - |
| QQ658_RS10900 (QQ658_10900) | 2365075..2365611 | + | 537 | WP_286024876.1 | GNAT family N-acetyltransferase | - |
| QQ658_RS10905 (QQ658_10905) | 2365725..2365958 | + | 234 | WP_286024877.1 | toxin-antitoxin system | - |
| QQ658_RS10910 (QQ658_10910) | 2365955..2366374 | + | 420 | WP_286024878.1 | type II toxin-antitoxin system VapC family toxin | - |
| QQ658_RS10915 (QQ658_10915) | 2366483..2366614 | + | 132 | WP_286024879.1 | hypothetical protein | - |
| QQ658_RS10920 (QQ658_10920) | 2366696..2367832 | - | 1137 | WP_286024880.1 | YbfB/YjiJ family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10906.49 Da Isoelectric Point: 9.1493
>T284238 WP_286024872.1 NZ_CP127390:2362544-2362825 [Propionimicrobium sp. PCR01-08-3]
VIRSFADKQTERLFMRETVRTLDPQIQRNALIKLWLLDAADTLQDLRIPPGNHLEALHGDRTGQHSIRINKKWRICFTWT
KAGPTEVEITDYH
VIRSFADKQTERLFMRETVRTLDPQIQRNALIKLWLLDAADTLQDLRIPPGNHLEALHGDRTGQHSIRINKKWRICFTWT
KAGPTEVEITDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|