Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1021195..1021865 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | QQ658_RS04775 | Protein ID | WP_286026525.1 |
| Coordinates | 1021195..1021545 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | QQ658_RS04780 | Protein ID | WP_286027029.1 |
| Coordinates | 1021551..1021865 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS04750 (QQ658_04750) | 1017237..1018580 | + | 1344 | WP_286026520.1 | MFS transporter | - |
| QQ658_RS04755 (QQ658_04755) | 1018577..1019551 | + | 975 | WP_286026521.1 | 2-hydroxyacid dehydrogenase | - |
| QQ658_RS04760 (QQ658_04760) | 1019816..1020367 | + | 552 | WP_286026522.1 | hypothetical protein | - |
| QQ658_RS04765 (QQ658_04765) | 1020349..1020981 | + | 633 | WP_286026523.1 | RES family NAD+ phosphorylase | - |
| QQ658_RS04770 (QQ658_04770) | 1020978..1021157 | - | 180 | WP_286026524.1 | hypothetical protein | - |
| QQ658_RS04775 (QQ658_04775) | 1021195..1021545 | + | 351 | WP_286026525.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQ658_RS04780 (QQ658_04780) | 1021551..1021865 | + | 315 | WP_286027029.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QQ658_RS04785 (QQ658_04785) | 1022166..1023206 | + | 1041 | WP_286026526.1 | LacI family DNA-binding transcriptional regulator | - |
| QQ658_RS04790 (QQ658_04790) | 1023374..1024990 | + | 1617 | WP_286026527.1 | CoA-transferase | - |
| QQ658_RS04795 (QQ658_04795) | 1024990..1025817 | + | 828 | WP_286026528.1 | enoyl-CoA hydratase/isomerase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13181.13 Da Isoelectric Point: 7.2064
>T284233 WP_286026525.1 NZ_CP127390:1021195-1021545 [Propionimicrobium sp. PCR01-08-3]
MWSVDVELIEVWLDSLDAGSRRQVMAAIELLRDLGPQLGRPLVDTVSAFRHKNMKELRPGSSGRSELRILFAFDPERSAI
MLIAGDKSGDWKRWYKKKIPEADGLFDDHLRGSKGE
MWSVDVELIEVWLDSLDAGSRRQVMAAIELLRDLGPQLGRPLVDTVSAFRHKNMKELRPGSSGRSELRILFAFDPERSAI
MLIAGDKSGDWKRWYKKKIPEADGLFDDHLRGSKGE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|