Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4236119..4236709 | Replicon | chromosome |
Accession | NZ_CP127378 | ||
Organism | Xanthomonas fragariae strain LMG 703 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A1Y6HPD3 |
Locus tag | OW158_RS19815 | Protein ID | WP_002803897.1 |
Coordinates | 4236428..4236709 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | OW158_RS19810 | Protein ID | WP_002803896.1 |
Coordinates | 4236119..4236409 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OW158_RS19780 (OW158_19780) | 4231624..4232592 | - | 969 | WP_088057082.1 | IS5 family transposase | - |
OW158_RS19785 (OW158_19785) | 4232837..4233850 | - | 1014 | WP_082244192.1 | hypothetical protein | - |
OW158_RS19790 (OW158_19790) | 4233986..4234633 | - | 648 | WP_088057083.1 | transposase | - |
OW158_RS19795 (OW158_19795) | 4234739..4235041 | - | 303 | WP_145954077.1 | hypothetical protein | - |
OW158_RS19800 (OW158_19800) | 4235243..4235575 | + | 333 | WP_002803887.1 | hypothetical protein | - |
OW158_RS19805 (OW158_19805) | 4235736..4235932 | + | 197 | Protein_3816 | hypothetical protein | - |
OW158_RS19810 (OW158_19810) | 4236119..4236409 | - | 291 | WP_002803896.1 | HigA family addiction module antitoxin | Antitoxin |
OW158_RS19815 (OW158_19815) | 4236428..4236709 | - | 282 | WP_002803897.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OW158_RS19820 (OW158_19820) | 4237173..4239248 | - | 2076 | WP_065975458.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10897.61 Da Isoelectric Point: 9.7550
>T284214 WP_002803897.1 NZ_CP127378:c4236709-4236428 [Xanthomonas fragariae]
MIKSIVDKEAEKIWVGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQLRICFRWM
EGDVAEVEIVDYH
MIKSIVDKEAEKIWVGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQLRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|