Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47838..48092 | Replicon | plasmid pCh102 |
| Accession | NZ_CP127317 | ||
| Organism | Escherichia coli strain Ch1 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | QRM71_RS26555 | Protein ID | WP_001312851.1 |
| Coordinates | 47838..47987 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 48036..48092 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM71_RS26515 (43491) | 43491..43589 | - | 99 | WP_225379473.1 | helix-turn-helix domain-containing protein | - |
| QRM71_RS26520 (43618) | 43618..43794 | - | 177 | Protein_65 | hypothetical protein | - |
| QRM71_RS26525 (43763) | 43763..44515 | + | 753 | Protein_66 | IS110-like element ISEc20 family transposase | - |
| QRM71_RS26530 (44571) | 44571..44858 | - | 288 | WP_000865085.1 | helix-turn-helix transcriptional regulator | - |
| QRM71_RS26535 (44858) | 44858..45169 | - | 312 | WP_021534912.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QRM71_RS26540 (46139) | 46139..46993 | - | 855 | Protein_69 | incFII family plasmid replication initiator RepA | - |
| QRM71_RS26545 (46986) | 46986..47060 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| QRM71_RS26550 (47294) | 47294..47554 | - | 261 | WP_021536205.1 | replication regulatory protein RepA | - |
| QRM71_RS26555 (47838) | 47838..47987 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (48036) | 48036..48092 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (48036) | 48036..48092 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (48036) | 48036..48092 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (48036) | 48036..48092 | + | 57 | NuclAT_1 | - | Antitoxin |
| QRM71_RS26560 (48259) | 48259..48708 | - | 450 | WP_098717018.1 | hypothetical protein | - |
| QRM71_RS26565 (48862) | 48862..49452 | - | 591 | WP_285978926.1 | DUF2726 domain-containing protein | - |
| QRM71_RS26570 (49490) | 49490..49699 | - | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| QRM71_RS26575 (49745) | 49745..50205 | - | 461 | Protein_76 | thermonuclease family protein | - |
| QRM71_RS26580 (50450) | 50450..50662 | - | 213 | WP_032161968.1 | hypothetical protein | - |
| QRM71_RS26585 (50793) | 50793..51353 | - | 561 | WP_032172786.1 | fertility inhibition protein FinO | - |
| QRM71_RS26590 (51408) | 51408..52154 | - | 747 | WP_285978927.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..72585 | 72585 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T284193 WP_001312851.1 NZ_CP127317:c47987-47838 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 57 bp
>AT284193 NZ_CP127317:48036-48092 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
