Detailed information of TA system TA284190

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 15007..15433
• Replicon: plasmid pCh102
• Accession: NZ_CP127317
• Organism: Escherichia coli strain Ch1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QRM71_RS26310
• Protein ID: WP_001372321.1
• Coordinates: 15007..15132 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	15209..15433 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QRM71_RS26275 (10059)	10059..10286	-	228	WP_285978930.1	conjugal transfer relaxosome protein TraY	-
QRM71_RS26280 (10380)	10380..11065	-	686	Protein_17	PAS domain-containing protein	-
QRM71_RS26285 (11256)	11256..11639	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QRM71_RS26290 (11916)	11916..12563	+	648	WP_000614935.1	transglycosylase SLT domain-containing protein	-
QRM71_RS26295 (12859)	12859..13680	-	822	WP_032172795.1	DUF932 domain-containing protein	-
QRM71_RS26300 (13799)	13799..14086	-	288	WP_000107526.1	hypothetical protein	-
QRM71_RS26305 (14387)	14387..14560	+	174	Protein_22	hypothetical protein	-
QRM71_RS26310 (15007)	15007..15132	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QRM71_RS26315 (15074)	15074..15223	-	150	Protein_24	plasmid maintenance protein Mok	-
- (15209)	15209..15433	-	225	NuclAT_0	-	Antitoxin
- (15209)	15209..15433	-	225	NuclAT_0	-	Antitoxin
- (15209)	15209..15433	-	225	NuclAT_0	-	Antitoxin
- (15209)	15209..15433	-	225	NuclAT_0	-	Antitoxin
QRM71_RS26320 (15245)	15245..15433	+	189	WP_001299721.1	hypothetical protein	-
QRM71_RS26325 (15402)	15402..16164	-	763	Protein_26	plasmid SOS inhibition protein A	-
QRM71_RS26330 (16161)	16161..16595	-	435	WP_097483708.1	conjugation system SOS inhibitor PsiB	-
QRM71_RS26335 (16650)	16650..18608	-	1959	WP_208483701.1	ParB/RepB/Spo0J family partition protein	-
QRM71_RS26340 (18667)	18667..18900	-	234	WP_000006004.1	DUF905 domain-containing protein	-
QRM71_RS26345 (18956)	18956..19483	-	528	WP_072649737.1	single-stranded DNA-binding protein	-
QRM71_RS26350 (19840)	19840..20052	+	213	WP_162137382.1	hypothetical protein	-
QRM71_RS26355 (19956)	19956..20240	-	285	WP_072165043.1	hypothetical protein	-
QRM71_RS26360 (20126)	20126..20392	-	267	WP_001697809.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..72585	72585

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T284190 WP_001372321.1 NZ_CP127317:c15132-15007 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT284190 NZ_CP127317:c15433-15209 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin