Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4591399..4592093 Replicon chromosome
Accession NZ_CP127316
Organism Escherichia coli strain Ch1

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag QRM71_RS22375 Protein ID WP_001521903.1
Coordinates 4591695..4592093 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag QRM71_RS22370 Protein ID WP_000554755.1
Coordinates 4591399..4591692 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM71_RS22345 (4587021) 4587021..4587377 - 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -
QRM71_RS22350 (4587370) 4587370..4587648 - 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
QRM71_RS22355 (4587753) 4587753..4589465 - 1713 Protein_4365 flagellar biosynthesis protein FlhA -
QRM71_RS22360 (4589437) 4589437..4590222 + 786 WP_073268583.1 putative lateral flagellar export/assembly protein LafU -
QRM71_RS22365 (4590344) 4590344..4591347 + 1004 Protein_4367 DNA polymerase IV -
QRM71_RS22370 (4591399) 4591399..4591692 + 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
QRM71_RS22375 (4591695) 4591695..4592093 + 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
QRM71_RS22380 (4592103) 4592103..4592555 + 453 WP_023144376.1 GNAT family N-acetyltransferase -
QRM71_RS22385 (4592800) 4592800..4593006 + 207 Protein_4371 RtcB family protein -
QRM71_RS22390 (4593002) 4593002..4593354 + 353 Protein_4372 peptide chain release factor H -
QRM71_RS22395 (4593411) 4593411..4594868 - 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
QRM71_RS22400 (4595129) 4595129..4595587 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (4596183) 4596183..4596263 + 81 NuclAT_10 - -
- (4596183) 4596183..4596263 + 81 NuclAT_10 - -
- (4596183) 4596183..4596263 + 81 NuclAT_10 - -
- (4596183) 4596183..4596263 + 81 NuclAT_10 - -
QRM71_RS22405 (4595679) 4595679..4596923 + 1245 WP_032353095.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T284186 WP_001521903.1 NZ_CP127316:4591695-4592093 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT284186 WP_000554755.1 NZ_CP127316:4591399-4591692 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References